468 items
NAME ↑ SIZE MODIFIED PERMS ACTIONS
.. / Parent Directory
7za — 49 B
2024-10-04 01:49 · rwxr-xr-x
49 B 2024-10-04 01:49 rwxr-xr-x
[ — 51.8 KB
2025-03-12 12:52 · rwxr-xr-x
51.8 KB 2025-03-12 12:52 rwxr-xr-x
aclocal — 35.52 KB
2023-09-27 12:16 · rwxr-xr-x
35.52 KB 2023-09-27 12:16 rwxr-xr-x
aclocal-1.16 — 35.52 KB
2023-09-27 12:16 · rwxr-xr-x
35.52 KB 2023-09-27 12:16 rwxr-xr-x
addr2line — 27.75 KB
2025-12-18 14:37 · rwxr-xr-x
27.75 KB 2025-12-18 14:37 rwxr-xr-x
ar — 55.98 KB
2025-12-18 14:37 · rwxr-xr-x
55.98 KB 2025-12-18 14:37 rwxr-xr-x
arch — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
arpaname — 15.11 KB
2026-04-15 05:39 · rwxr-xr-x
15.11 KB 2026-04-15 05:39 rwxr-xr-x
as — 710.32 KB
2025-12-18 14:37 · rwxr-xr-x
710.32 KB 2025-12-18 14:37 rwxr-xr-x
aspell — 151.12 KB
2022-01-26 21:47 · rwxr-xr-x
151.12 KB 2022-01-26 21:47 rwxr-xr-x
autoconf — 14.42 KB
2025-09-21 12:23 · rwxr-xr-x
14.42 KB 2025-09-21 12:23 rwxr-xr-x
autoheader — 8.33 KB
2025-09-21 12:23 · rwxr-xr-x
8.33 KB 2025-09-21 12:23 rwxr-xr-x
autom4te — 31.43 KB
2025-09-21 12:23 · rwxr-xr-x
31.43 KB 2025-09-21 12:23 rwxr-xr-x
automake — 251.93 KB
2023-09-27 12:16 · rwxr-xr-x
251.93 KB 2023-09-27 12:16 rwxr-xr-x
automake-1.16 — 251.93 KB
2023-09-27 12:16 · rwxr-xr-x
251.93 KB 2023-09-27 12:16 rwxr-xr-x
autoreconf — 20.57 KB
2025-09-21 12:23 · rwxr-xr-x
20.57 KB 2025-09-21 12:23 rwxr-xr-x
autoscan — 16.72 KB
2025-09-21 12:23 · rwxr-xr-x
16.72 KB 2025-09-21 12:23 rwxr-xr-x
autoupdate — 33.08 KB
2025-09-21 12:23 · rwxr-xr-x
33.08 KB 2025-09-21 12:23 rwxr-xr-x
awk LINK — 698.17 KB
2022-03-30 22:25 · rwxr-xr-x
698.17 KB 2022-03-30 22:25 rwxr-xr-x
b2sum — 51.79 KB
2025-03-12 12:52 · rwxr-xr-x
51.79 KB 2025-03-12 12:52 rwxr-xr-x
base32 — 35.69 KB
2025-03-12 12:52 · rwxr-xr-x
35.69 KB 2025-03-12 12:52 rwxr-xr-x
base64 — 35.7 KB
2025-03-12 12:52 · rwxr-xr-x
35.7 KB 2025-03-12 12:52 rwxr-xr-x
basename — 35.67 KB
2025-03-12 12:52 · rwxr-xr-x
35.67 KB 2025-03-12 12:52 rwxr-xr-x
basenc — 48.02 KB
2025-03-12 12:52 · rwxr-xr-x
48.02 KB 2025-03-12 12:52 rwxr-xr-x
bash — 1.32 MB
2024-04-30 14:33 · rwxr-xr-x
1.32 MB 2024-04-30 14:33 rwxr-xr-x
bashbug-64 — 6.91 KB
2024-04-30 14:33 · rwxr-xr-x
6.91 KB 2024-04-30 14:33 rwxr-xr-x
bun LINK — 88.46 MB
2026-05-12 22:48 · rwxr-xr-x
88.46 MB 2026-05-12 22:48 rwxr-xr-x
bunzip2 LINK — 39.62 KB
2025-02-04 03:42 · rwxr-xr-x
39.62 KB 2025-02-04 03:42 rwxr-xr-x
bzcat LINK — 39.62 KB
2025-02-04 03:42 · rwxr-xr-x
39.62 KB 2025-02-04 03:42 rwxr-xr-x
bzcmp LINK — 2.09 KB
2025-02-04 03:42 · rwxr-xr-x
2.09 KB 2025-02-04 03:42 rwxr-xr-x
bzdiff — 2.09 KB
2025-02-04 03:42 · rwxr-xr-x
2.09 KB 2025-02-04 03:42 rwxr-xr-x
bzgrep — 2.01 KB
2025-02-04 03:42 · rwxr-xr-x
2.01 KB 2025-02-04 03:42 rwxr-xr-x
bzip2 — 39.62 KB
2025-02-04 03:42 · rwxr-xr-x
39.62 KB 2025-02-04 03:42 rwxr-xr-x
bzip2recover — 15.4 KB
2025-02-04 03:42 · rwxr-xr-x
15.4 KB 2025-02-04 03:42 rwxr-xr-x
bzless LINK — 1.23 KB
2025-02-04 03:42 · rwxr-xr-x
1.23 KB 2025-02-04 03:42 rwxr-xr-x
bzmore — 1.23 KB
2025-02-04 03:42 · rwxr-xr-x
1.23 KB 2025-02-04 03:42 rwxr-xr-x
c++ — 1.05 MB
2025-09-15 15:46 · rwxr-xr-x
1.05 MB 2025-09-15 15:46 rwxr-xr-x
c++filt — 27.19 KB
2025-12-18 14:37 · rwxr-xr-x
27.19 KB 2025-12-18 14:37 rwxr-xr-x
cagefs_enter.proxied — 1.27 KB
2026-08-14 07:06 · rwxr-xr-x
1.27 KB 2026-08-14 07:06 rwxr-xr-x
cal — 51.83 KB
2026-02-04 21:11 · rwxr-xr-x
51.83 KB 2026-02-04 21:11 rwxr-xr-x
captoinfo LINK — 87.79 KB
2025-09-21 09:23 · rwxr-xr-x
87.79 KB 2025-09-21 09:23 rwxr-xr-x
cat — 35.66 KB
2025-03-12 12:52 · rwxr-xr-x
35.66 KB 2025-03-12 12:52 rwxr-xr-x
catchsegv — 3.21 KB
2026-08-03 10:12 · rwxr-xr-x
3.21 KB 2026-08-03 10:12 rwxr-xr-x
cc LINK — 0 B
1970-01-01 00:00 · ---------
0 B 1970-01-01 00:00 ---------
chcon — 60.24 KB
2025-03-12 12:52 · rwxr-xr-x
60.24 KB 2025-03-12 12:52 rwxr-xr-x
chgrp — 56.19 KB
2025-03-12 12:52 · rwxr-xr-x
56.19 KB 2025-03-12 12:52 rwxr-xr-x
chmod — 56.16 KB
2025-03-12 12:52 · rwxr-xr-x
56.16 KB 2025-03-12 12:52 rwxr-xr-x
chown — 60.19 KB
2025-03-12 12:52 · rwxr-xr-x
60.19 KB 2025-03-12 12:52 rwxr-xr-x
chrt — 27.31 KB
2026-02-04 21:11 · rwxr-xr-x
27.31 KB 2026-02-04 21:11 rwxr-xr-x
cksum — 35.57 KB
2025-03-12 12:52 · rwxr-xr-x
35.57 KB 2025-03-12 12:52 rwxr-xr-x
clear — 15.15 KB
2025-09-21 09:23 · rwxr-xr-x
15.15 KB 2025-09-21 09:23 rwxr-xr-x
cloudlinux-awp-user LINK — 1.78 KB
2026-04-27 11:11 · rwxr-xr-x
1.78 KB 2026-04-27 11:11 rwxr-xr-x
clwpos-user — 1.78 KB
2026-04-27 11:11 · rwxr-xr-x
1.78 KB 2026-04-27 11:11 rwxr-xr-x
cmp — 40.13 KB
2022-01-29 18:15 · rwxr-xr-x
40.13 KB 2022-01-29 18:15 rwxr-xr-x
col — 23.23 KB
2026-02-04 21:11 · rwxr-xr-x
23.23 KB 2026-02-04 21:11 rwxr-xr-x
colcrt — 15.19 KB
2026-02-04 21:11 · rwxr-xr-x
15.19 KB 2026-02-04 21:11 rwxr-xr-x
colrm — 15.16 KB
2026-02-04 21:11 · rwxr-xr-x
15.16 KB 2026-02-04 21:11 rwxr-xr-x
column — 35.34 KB
2026-02-04 21:11 · rwxr-xr-x
35.34 KB 2026-02-04 21:11 rwxr-xr-x
comm — 35.75 KB
2025-03-12 12:52 · rwxr-xr-x
35.75 KB 2025-03-12 12:52 rwxr-xr-x
cp — 149.24 KB
2025-03-12 12:52 · rwxr-xr-x
149.24 KB 2025-03-12 12:52 rwxr-xr-x
cpp — 1.05 MB
2025-09-15 15:46 · rwxr-xr-x
1.05 MB 2025-09-15 15:46 rwxr-xr-x
csplit — 108.88 KB
2025-03-12 12:52 · rwxr-xr-x
108.88 KB 2025-03-12 12:52 rwxr-xr-x
curl — 248.48 KB
2026-01-28 08:27 · rwxr-xr-x
248.48 KB 2026-01-28 08:27 rwxr-xr-x
cut — 47.8 KB
2025-03-12 12:52 · rwxr-xr-x
47.8 KB 2025-03-12 12:52 rwxr-xr-x
cyrusbdb2current — 1.58 MB
2025-09-25 11:46 · rwxr-xr-x
1.58 MB 2025-09-25 11:46 rwxr-xr-x
date — 104.05 KB
2025-03-12 12:52 · rwxr-xr-x
104.05 KB 2025-03-12 12:52 rwxr-xr-x
dbiprof — 6.06 KB
2022-02-16 08:03 · rwxr-xr-x
6.06 KB 2022-02-16 08:03 rwxr-xr-x
delv — 45.38 KB
2026-04-15 05:39 · rwxr-xr-x
45.38 KB 2026-04-15 05:39 rwxr-xr-x
df — 84.73 KB
2025-03-12 12:52 · rwxr-xr-x
84.73 KB 2025-03-12 12:52 rwxr-xr-x
diff — 194.7 KB
2022-01-29 18:15 · rwxr-xr-x
194.7 KB 2022-01-29 18:15 rwxr-xr-x
diff3 — 52.3 KB
2022-01-29 18:15 · rwxr-xr-x
52.3 KB 2022-01-29 18:15 rwxr-xr-x
dig — 136.59 KB
2026-04-15 05:39 · rwxr-xr-x
136.59 KB 2026-04-15 05:39 rwxr-xr-x
dir — 137.65 KB
2025-03-12 12:52 · rwxr-xr-x
137.65 KB 2025-03-12 12:52 rwxr-xr-x
dircolors — 39.8 KB
2025-03-12 12:52 · rwxr-xr-x
39.8 KB 2025-03-12 12:52 rwxr-xr-x
dirname — 31.48 KB
2025-03-12 12:52 · rwxr-xr-x
31.48 KB 2025-03-12 12:52 rwxr-xr-x
dltest — 15.68 KB
2022-02-11 06:55 · rwxr-xr-x
15.68 KB 2022-02-11 06:55 rwxr-xr-x
dnstap-read — 23.19 KB
2026-04-15 05:39 · rwxr-xr-x
23.19 KB 2026-04-15 05:39 rwxr-xr-x
du — 149.44 KB
2025-03-12 12:52 · rwxr-xr-x
149.44 KB 2025-03-12 12:52 rwxr-xr-x
echo — 35.48 KB
2025-03-12 12:52 · rwxr-xr-x
35.48 KB 2025-03-12 12:52 rwxr-xr-x
ed — 52.51 KB
2022-01-30 05:02 · rwxr-xr-x
52.51 KB 2022-01-30 05:02 rwxr-xr-x
egrep — 32 B
2022-01-31 20:22 · rwxr-xr-x
32 B 2022-01-31 20:22 rwxr-xr-x
enchant — 23.73 KB
2022-01-30 11:02 · rwxr-xr-x
23.73 KB 2022-01-30 11:02 rwxr-xr-x
enchant-lsmod — 15.8 KB
2022-01-30 11:02 · rwxr-xr-x
15.8 KB 2022-01-30 11:02 rwxr-xr-x
env — 44.23 KB
2025-03-12 12:52 · rwxr-xr-x
44.23 KB 2025-03-12 12:52 rwxr-xr-x
eps2eps — 643 B
2025-05-14 16:03 · rwxr-xr-x
643 B 2025-05-14 16:03 rwxr-xr-x
eqn — 189.52 KB
2022-02-01 10:44 · rwxr-xr-x
189.52 KB 2022-02-01 10:44 rwxr-xr-x
ex LINK — 1.38 MB
2026-04-29 09:50 · rwxr-xr-x
1.38 MB 2026-04-29 09:50 rwxr-xr-x
expand — 39.73 KB
2025-03-12 12:52 · rwxr-xr-x
39.73 KB 2025-03-12 12:52 rwxr-xr-x
expr — 108.6 KB
2025-03-12 12:52 · rwxr-xr-x
108.6 KB 2025-03-12 12:52 rwxr-xr-x
factor — 72.05 KB
2025-03-12 12:52 · rwxr-xr-x
72.05 KB 2025-03-12 12:52 rwxr-xr-x
false — 27.47 KB
2025-03-12 12:52 · rwxr-xr-x
27.47 KB 2025-03-12 12:52 rwxr-xr-x
fc-cache — 139 B
2023-01-23 15:48 · rwxr-xr-x
139 B 2023-01-23 15:48 rwxr-xr-x
fc-cache-64 — 23.17 KB
2023-01-23 19:48 · rwxr-xr-x
23.17 KB 2023-01-23 19:48 rwxr-xr-x
fc-cat — 19.16 KB
2023-01-23 19:48 · rwxr-xr-x
19.16 KB 2023-01-23 19:48 rwxr-xr-x
fc-conflist — 15.13 KB
2023-01-23 19:48 · rwxr-xr-x
15.13 KB 2023-01-23 19:48 rwxr-xr-x
fc-list — 15.13 KB
2023-01-23 19:48 · rwxr-xr-x
15.13 KB 2023-01-23 19:48 rwxr-xr-x
fc-match — 15.13 KB
2023-01-23 19:48 · rwxr-xr-x
15.13 KB 2023-01-23 19:48 rwxr-xr-x
fc-pattern — 15.14 KB
2023-01-23 19:48 · rwxr-xr-x
15.14 KB 2023-01-23 19:48 rwxr-xr-x
fc-query — 15.13 KB
2023-01-23 19:48 · rwxr-xr-x
15.13 KB 2023-01-23 19:48 rwxr-xr-x
fc-scan — 15.14 KB
2023-01-23 19:48 · rwxr-xr-x
15.14 KB 2023-01-23 19:48 rwxr-xr-x
fc-validate — 15.14 KB
2023-01-23 19:48 · rwxr-xr-x
15.14 KB 2023-01-23 19:48 rwxr-xr-x
fgrep — 32 B
2022-01-31 20:22 · rwxr-xr-x
32 B 2022-01-31 20:22 rwxr-xr-x
file — 27.74 KB
2024-04-03 12:38 · rwxr-xr-x
27.74 KB 2024-04-03 12:38 rwxr-xr-x
find — 284.95 KB
2024-10-02 21:04 · rwxr-xr-x
284.95 KB 2024-10-02 21:04 rwxr-xr-x
flock — 23.37 KB
2026-02-04 21:11 · rwxr-xr-x
23.37 KB 2026-02-04 21:11 rwxr-xr-x
fmt — 39.77 KB
2025-03-12 12:52 · rwxr-xr-x
39.77 KB 2025-03-12 12:52 rwxr-xr-x
fold — 39.71 KB
2025-03-12 12:52 · rwxr-xr-x
39.71 KB 2025-03-12 12:52 rwxr-xr-x
free — 23.36 KB
2024-04-30 16:43 · rwxr-xr-x
23.36 KB 2024-04-30 16:43 rwxr-xr-x
funzip — 31.25 KB
2025-09-21 11:04 · rwxr-xr-x
31.25 KB 2025-09-21 11:04 rwxr-xr-x
g++ — 1.05 MB
2025-09-15 15:46 · rwxr-xr-x
1.05 MB 2025-09-15 15:46 rwxr-xr-x
gawk — 698.17 KB
2022-03-30 22:25 · rwxr-xr-x
698.17 KB 2022-03-30 22:25 rwxr-xr-x
gcc-ar — 27.67 KB
2025-09-15 15:46 · rwxr-xr-x
27.67 KB 2025-09-15 15:46 rwxr-xr-x
gcc-nm — 27.64 KB
2025-09-15 15:46 · rwxr-xr-x
27.64 KB 2025-09-15 15:46 rwxr-xr-x
gcc-ranlib — 27.67 KB
2025-09-15 15:46 · rwxr-xr-x
27.67 KB 2025-09-15 15:46 rwxr-xr-x
gcov-dump — 291.77 KB
2025-09-15 15:46 · rwxr-xr-x
291.77 KB 2025-09-15 15:46 rwxr-xr-x
gcov-tool — 320.46 KB
2025-09-15 15:46 · rwxr-xr-x
320.46 KB 2025-09-15 15:46 rwxr-xr-x
gencat — 27.45 KB
2026-08-03 10:14 · rwxr-xr-x
27.45 KB 2026-08-03 10:14 rwxr-xr-x
geoiplookup — 15.86 KB
2021-11-05 13:40 · rwxr-xr-x
15.86 KB 2021-11-05 13:40 rwxr-xr-x
geoiplookup6 — 15.81 KB
2021-11-05 13:40 · rwxr-xr-x
15.81 KB 2021-11-05 13:40 rwxr-xr-x
geqn LINK — 189.52 KB
2022-02-01 10:44 · rwxr-xr-x
189.52 KB 2022-02-01 10:44 rwxr-xr-x
getconf — 35.23 KB
2026-08-03 10:14 · rwxr-xr-x
35.23 KB 2026-08-03 10:14 rwxr-xr-x
getent — 35.86 KB
2026-08-03 10:14 · rwxr-xr-x
35.86 KB 2026-08-03 10:14 rwxr-xr-x
getopt — 23.27 KB
2026-02-04 21:11 · rwxr-xr-x
23.27 KB 2026-02-04 21:11 rwxr-xr-x
ghostscript LINK — 15.13 KB
2025-05-14 16:03 · rwxr-xr-x
15.13 KB 2025-05-14 16:03 rwxr-xr-x
gifdiff — 55.9 KB
2024-02-21 04:36 · rwxr-xr-x
55.9 KB 2024-02-21 04:36 rwxr-xr-x
gifsicle — 194.05 KB
2024-02-21 04:36 · rwxr-xr-x
194.05 KB 2024-02-21 04:36 rwxr-xr-x
git — 4.06 MB
2025-07-21 16:25 · rwxr-xr-x
4.06 MB 2025-07-21 16:25 rwxr-xr-x
git-receive-pack LINK — 4.06 MB
2025-07-21 16:25 · rwxr-xr-x
4.06 MB 2025-07-21 16:25 rwxr-xr-x
git-shell — 770.68 KB
2025-07-21 16:25 · rwxr-xr-x
770.68 KB 2025-07-21 16:25 rwxr-xr-x
git-upload-archive LINK — 4.06 MB
2025-07-21 16:25 · rwxr-xr-x
4.06 MB 2025-07-21 16:25 rwxr-xr-x
git-upload-pack LINK — 4.06 MB
2025-07-21 16:25 · rwxr-xr-x
4.06 MB 2025-07-21 16:25 rwxr-xr-x
gm — 15.67 KB
2022-11-23 17:49 · rwxr-xr-x
15.67 KB 2022-11-23 17:49 rwxr-xr-x
gneqn LINK — 916 B
2022-02-01 10:44 · rwxr-xr-x
916 B 2022-02-01 10:44 rwxr-xr-x
gnroff LINK — 3.21 KB
2022-02-01 10:44 · rwxr-xr-x
3.21 KB 2022-02-01 10:44 rwxr-xr-x
gpg — 1.07 MB
2026-01-15 21:34 · rwxr-xr-x
1.07 MB 2026-01-15 21:34 rwxr-xr-x
gpg-agent — 342.27 KB
2026-01-15 21:34 · rwxr-xr-x
342.27 KB 2026-01-15 21:34 rwxr-xr-x
gpg-error — 36.1 KB
2022-02-09 23:24 · rwxr-xr-x
36.1 KB 2022-02-09 23:24 rwxr-xr-x
gpgsplit — 27.5 KB
2026-01-15 21:34 · rwxr-xr-x
27.5 KB 2026-01-15 21:34 rwxr-xr-x
gpgv — 295.43 KB
2026-01-15 21:34 · rwxr-xr-x
295.43 KB 2026-01-15 21:34 rwxr-xr-x
gpic LINK — 201.72 KB
2022-02-01 10:44 · rwxr-xr-x
201.72 KB 2022-02-01 10:44 rwxr-xr-x
gprof — 101.48 KB
2025-12-18 14:37 · rwxr-xr-x
101.48 KB 2025-12-18 14:37 rwxr-xr-x
grep — 154.49 KB
2022-01-31 20:22 · rwxr-xr-x
154.49 KB 2022-01-31 20:22 rwxr-xr-x
groff — 96.77 KB
2022-02-01 10:44 · rwxr-xr-x
96.77 KB 2022-02-01 10:44 rwxr-xr-x
grops — 167.26 KB
2022-02-01 10:44 · rwxr-xr-x
167.26 KB 2022-02-01 10:44 rwxr-xr-x
grotty — 122.2 KB
2022-02-01 10:44 · rwxr-xr-x
122.2 KB 2022-02-01 10:44 rwxr-xr-x
groups — 35.66 KB
2025-03-12 12:52 · rwxr-xr-x
35.66 KB 2025-03-12 12:52 rwxr-xr-x
gs — 15.13 KB
2025-05-14 16:03 · rwxr-xr-x
15.13 KB 2025-05-14 16:03 rwxr-xr-x
gsnd — 281 B
2025-05-14 16:03 · rwxr-xr-x
281 B 2025-05-14 16:03 rwxr-xr-x
gsoelim LINK — 0 B
1970-01-01 00:00 · ---------
0 B 1970-01-01 00:00 ---------
gtar LINK — 518.16 KB
2026-01-05 19:41 · rwxr-xr-x
518.16 KB 2026-01-05 19:41 rwxr-xr-x
gtbl LINK — 130.86 KB
2022-02-01 10:44 · rwxr-xr-x
130.86 KB 2022-02-01 10:44 rwxr-xr-x
gtroff LINK — 732.07 KB
2022-02-01 10:44 · rwxr-xr-x
732.07 KB 2022-02-01 10:44 rwxr-xr-x
gunzip — 2.29 KB
2022-10-15 17:26 · rwxr-xr-x
2.29 KB 2022-10-15 17:26 rwxr-xr-x
gzexe — 6.3 KB
2022-10-15 17:26 · rwxr-xr-x
6.3 KB 2022-10-15 17:26 rwxr-xr-x
gzip — 89.63 KB
2022-10-15 17:26 · rwxr-xr-x
89.63 KB 2022-10-15 17:26 rwxr-xr-x
hdu — 18.09 KB
2024-11-26 18:13 · rwxr-xr-x
18.09 KB 2024-11-26 18:13 rwxr-xr-x
head — 43.8 KB
2025-03-12 12:52 · rwxr-xr-x
43.8 KB 2025-03-12 12:52 rwxr-xr-x
hexdump — 51.41 KB
2026-02-04 21:11 · rwxr-xr-x
51.41 KB 2026-02-04 21:11 rwxr-xr-x
host — 108.57 KB
2026-04-15 05:39 · rwxr-xr-x
108.57 KB 2026-04-15 05:39 rwxr-xr-x
hostid — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
hostname — 23.84 KB
2022-02-14 11:22 · rwxr-xr-x
23.84 KB 2022-02-14 11:22 rwxr-xr-x
hunspell — 102.67 KB
2022-01-31 20:22 · rwxr-xr-x
102.67 KB 2022-01-31 20:22 rwxr-xr-x
iconv — 64.09 KB
2026-08-03 10:14 · rwxr-xr-x
64.09 KB 2026-08-03 10:14 rwxr-xr-x
id — 39.71 KB
2025-03-12 12:52 · rwxr-xr-x
39.71 KB 2025-03-12 12:52 rwxr-xr-x
idn — 35.8 KB
2022-12-20 16:04 · rwxr-xr-x
35.8 KB 2022-12-20 16:04 rwxr-xr-x
ifnames — 4.03 KB
2025-09-21 12:23 · rwxr-xr-x
4.03 KB 2025-09-21 12:23 rwxr-xr-x
infocmp — 63.68 KB
2025-09-21 09:23 · rwxr-xr-x
63.68 KB 2025-09-21 09:23 rwxr-xr-x
infotocap LINK — 87.79 KB
2025-09-21 09:23 · rwxr-xr-x
87.79 KB 2025-09-21 09:23 rwxr-xr-x
install — 149.29 KB
2025-03-12 12:52 · rwxr-xr-x
149.29 KB 2025-03-12 12:52 rwxr-xr-x
ionice — 15.21 KB
2026-02-04 21:11 · rwxr-xr-x
15.21 KB 2026-02-04 21:11 rwxr-xr-x
ipcrm — 19.23 KB
2026-02-04 21:11 · rwxr-xr-x
19.23 KB 2026-02-04 21:11 rwxr-xr-x
ipcs — 39.34 KB
2026-02-04 21:11 · rwxr-xr-x
39.34 KB 2026-02-04 21:11 rwxr-xr-x
isosize — 15.16 KB
2026-02-04 21:11 · rwxr-xr-x
15.16 KB 2026-02-04 21:11 rwxr-xr-x
ispell — 992 B
2019-10-08 00:15 · rwxr-xr-x
992 B 2019-10-08 00:15 rwxr-xr-x
isql — 40.01 KB
2022-02-11 06:55 · rwxr-xr-x
40.01 KB 2022-02-11 06:55 rwxr-xr-x
iusql — 31.95 KB
2022-02-11 06:55 · rwxr-xr-x
31.95 KB 2022-02-11 06:55 rwxr-xr-x
join — 51.9 KB
2025-03-12 12:52 · rwxr-xr-x
51.9 KB 2025-03-12 12:52 rwxr-xr-x
jpegoptim — 48.83 KB
2023-08-12 17:24 · rwxr-xr-x
48.83 KB 2023-08-12 17:24 rwxr-xr-x
kill — 31.29 KB
2026-02-04 21:11 · rwxr-xr-x
31.29 KB 2026-02-04 21:11 rwxr-xr-x
ld LINK — 1.71 MB
2025-12-18 14:37 · rwxr-xr-x
1.71 MB 2025-12-18 14:37 rwxr-xr-x
ld.bfd — 1.71 MB
2025-12-18 14:37 · rwxr-xr-x
1.71 MB 2025-12-18 14:37 rwxr-xr-x
ldd — 5.32 KB
2026-08-03 10:12 · rwxr-xr-x
5.32 KB 2026-08-03 10:12 rwxr-xr-x
less — 197.7 KB
2025-09-21 12:35 · rwxr-xr-x
197.7 KB 2025-09-21 12:35 rwxr-xr-x
lessecho — 15.17 KB
2025-09-21 12:35 · rwxr-xr-x
15.17 KB 2025-09-21 12:35 rwxr-xr-x
lesskey — 24.61 KB
2025-09-21 12:35 · rwxr-xr-x
24.61 KB 2025-09-21 12:35 rwxr-xr-x
lesspipe.sh — 3.5 KB
2025-09-21 11:44 · rwxr-xr-x
3.5 KB 2025-09-21 11:44 rwxr-xr-x
link — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
ln — 60.16 KB
2025-03-12 12:52 · rwxr-xr-x
60.16 KB 2025-03-12 12:52 rwxr-xr-x
locale — 59.08 KB
2026-08-03 10:14 · rwxr-xr-x
59.08 KB 2026-08-03 10:14 rwxr-xr-x
localedef — 314.05 KB
2026-08-03 10:14 · rwxr-xr-x
314.05 KB 2026-08-03 10:14 rwxr-xr-x
logger — 35.98 KB
2026-02-04 21:11 · rwxr-xr-x
35.98 KB 2026-02-04 21:11 rwxr-xr-x
login — 43.45 KB
2026-02-04 21:11 · rwxr-xr-x
43.45 KB 2026-02-04 21:11 rwxr-xr-x
logname — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
look — 19.17 KB
2026-02-04 21:11 · rwxr-xr-x
19.17 KB 2026-02-04 21:11 rwxr-xr-x
ls — 137.64 KB
2025-03-12 12:52 · rwxr-xr-x
137.64 KB 2025-03-12 12:52 rwxr-xr-x
lto-dump — 26.59 MB
2025-09-15 15:46 · rwxr-xr-x
26.59 MB 2025-09-15 15:46 rwxr-xr-x
m4 — 240.4 KB
2022-03-31 07:28 · rwxr-xr-x
240.4 KB 2022-03-31 07:28 rwxr-xr-x
make-dummy-cert — 614 B
2026-01-28 16:17 · rwxr-xr-x
614 B 2026-01-28 16:17 rwxr-xr-x
mariadb — 5.05 MB
2026-08-19 14:11 · rwxr-xr-x
5.05 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-access — 109.48 KB
2026-08-19 13:13 · rwxr-xr-x
109.48 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-admin — 4.82 MB
2026-08-19 14:11 · rwxr-xr-x
4.82 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-binlog — 5.08 MB
2026-08-19 14:11 · rwxr-xr-x
5.08 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-check — 4.82 MB
2026-08-19 14:11 · rwxr-xr-x
4.82 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-conv — 4.55 MB
2026-08-19 14:11 · rwxr-xr-x
4.55 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-convert-table-format — 4.28 KB
2026-08-19 13:13 · rwxr-xr-x
4.28 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-dump — 4.92 MB
2026-08-19 14:11 · rwxr-xr-x
4.92 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-dumpslow — 8.19 KB
2026-08-19 13:13 · rwxr-xr-x
8.19 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-embedded — 23.91 MB
2026-08-19 14:11 · rwxr-xr-x
23.91 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-find-rows — 3.35 KB
2026-08-19 13:13 · rwxr-xr-x
3.35 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-hotcopy — 34.67 KB
2026-08-19 13:13 · rwxr-xr-x
34.67 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-import — 4.9 MB
2026-08-19 14:11 · rwxr-xr-x
4.9 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-plugin — 4.53 MB
2026-08-19 14:11 · rwxr-xr-x
4.53 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-secure-installation — 13.66 KB
2026-08-19 13:13 · rwxr-xr-x
13.66 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-setpermission — 17.7 KB
2026-08-19 13:13 · rwxr-xr-x
17.7 KB 2026-08-19 13:13 rwxr-xr-x
mariadb-show — 4.81 MB
2026-08-19 14:11 · rwxr-xr-x
4.81 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-slap — 4.83 MB
2026-08-19 14:11 · rwxr-xr-x
4.83 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-tzinfo-to-sql — 4.52 MB
2026-08-19 14:11 · rwxr-xr-x
4.52 MB 2026-08-19 14:11 rwxr-xr-x
mariadb-waitpid — 4.51 MB
2026-08-19 14:11 · rwxr-xr-x
4.51 MB 2026-08-19 14:11 rwxr-xr-x
mc — 1.22 MB
2022-02-10 07:09 · rwxr-xr-x
1.22 MB 2022-02-10 07:09 rwxr-xr-x
mcdiff LINK — 1.22 MB
2022-02-10 07:09 · rwxr-xr-x
1.22 MB 2022-02-10 07:09 rwxr-xr-x
mcedit LINK — 1.22 MB
2022-02-10 07:09 · rwxr-xr-x
1.22 MB 2022-02-10 07:09 rwxr-xr-x
mcookie — 27.31 KB
2026-02-04 21:11 · rwxr-xr-x
27.31 KB 2026-02-04 21:11 rwxr-xr-x
mcview LINK — 1.22 MB
2022-02-10 07:09 · rwxr-xr-x
1.22 MB 2022-02-10 07:09 rwxr-xr-x
md5sum — 39.64 KB
2025-03-12 12:52 · rwxr-xr-x
39.64 KB 2025-03-12 12:52 rwxr-xr-x
mesg — 15.14 KB
2026-02-04 21:11 · rwxr-xr-x
15.14 KB 2026-02-04 21:11 rwxr-xr-x
mkdir — 68.31 KB
2025-03-12 12:52 · rwxr-xr-x
68.31 KB 2025-03-12 12:52 rwxr-xr-x
mkfifo — 39.83 KB
2025-03-12 12:52 · rwxr-xr-x
39.83 KB 2025-03-12 12:52 rwxr-xr-x
mknod — 43.88 KB
2025-03-12 12:52 · rwxr-xr-x
43.88 KB 2025-03-12 12:52 rwxr-xr-x
mktemp — 39.8 KB
2025-03-12 12:52 · rwxr-xr-x
39.8 KB 2025-03-12 12:52 rwxr-xr-x
more — 43.43 KB
2026-02-04 21:11 · rwxr-xr-x
43.43 KB 2026-02-04 21:11 rwxr-xr-x
msmtp — 133.98 KB
2026-03-26 13:24 · rwxr-xr-x
133.98 KB 2026-03-26 13:24 rwxr-xr-x
msmtpd — 35.68 KB
2026-03-26 13:24 · rwxr-xr-x
35.68 KB 2026-03-26 13:24 rwxr-xr-x
msql2mysql — 1.42 KB
2026-08-19 13:13 · rwxr-xr-x
1.42 KB 2026-08-19 13:13 rwxr-xr-x
mv — 141.17 KB
2025-03-12 12:52 · rwxr-xr-x
141.17 KB 2025-03-12 12:52 rwxr-xr-x
my_print_defaults — 4.52 MB
2026-08-19 14:11 · rwxr-xr-x
4.52 MB 2026-08-19 14:11 rwxr-xr-x
mysql — 5.05 MB
2026-08-19 14:11 · rwxr-xr-x
5.05 MB 2026-08-19 14:11 rwxr-xr-x
mysql_config — 4.47 KB
2026-08-19 13:13 · rwxr-xr-x
4.47 KB 2026-08-19 13:13 rwxr-xr-x
mysql_find_rows LINK — 3.35 KB
2026-08-19 13:13 · rwxr-xr-x
3.35 KB 2026-08-19 13:13 rwxr-xr-x
mysql_waitpid LINK — 4.51 MB
2026-08-19 14:11 · rwxr-xr-x
4.51 MB 2026-08-19 14:11 rwxr-xr-x
mysqlaccess LINK — 109.48 KB
2026-08-19 13:13 · rwxr-xr-x
109.48 KB 2026-08-19 13:13 rwxr-xr-x
mysqladmin LINK — 4.82 MB
2026-08-19 14:11 · rwxr-xr-x
4.82 MB 2026-08-19 14:11 rwxr-xr-x
mysqlbinlog LINK — 5.08 MB
2026-08-19 14:11 · rwxr-xr-x
5.08 MB 2026-08-19 14:11 rwxr-xr-x
mysqlcheck — 4.82 MB
2026-08-19 14:11 · rwxr-xr-x
4.82 MB 2026-08-19 14:11 rwxr-xr-x
mysqldump — 4.92 MB
2026-08-19 14:11 · rwxr-xr-x
4.92 MB 2026-08-19 14:11 rwxr-xr-x
mysqlimport LINK — 4.9 MB
2026-08-19 14:11 · rwxr-xr-x
4.9 MB 2026-08-19 14:11 rwxr-xr-x
mysqlshow LINK — 4.81 MB
2026-08-19 14:11 · rwxr-xr-x
4.81 MB 2026-08-19 14:11 rwxr-xr-x
mytop — 72.03 KB
2026-08-19 13:13 · rwxr-xr-x
72.03 KB 2026-08-19 13:13 rwxr-xr-x
namei — 23.23 KB
2026-02-04 21:11 · rwxr-xr-x
23.23 KB 2026-02-04 21:11 rwxr-xr-x
nano — 346.2 KB
2025-03-13 03:12 · rwxr-xr-x
346.2 KB 2025-03-13 03:12 rwxr-xr-x
neqn — 916 B
2022-02-01 10:44 · rwxr-xr-x
916 B 2022-02-01 10:44 rwxr-xr-x
nice — 35.67 KB
2025-03-12 12:52 · rwxr-xr-x
35.67 KB 2025-03-12 12:52 rwxr-xr-x
nl — 100.71 KB
2025-03-12 12:52 · rwxr-xr-x
100.71 KB 2025-03-12 12:52 rwxr-xr-x
nm — 44.73 KB
2025-12-18 14:37 · rwxr-xr-x
44.73 KB 2025-12-18 14:37 rwxr-xr-x
nohup — 35.58 KB
2025-03-12 12:52 · rwxr-xr-x
35.58 KB 2025-03-12 12:52 rwxr-xr-x
nproc — 35.69 KB
2025-03-12 12:52 · rwxr-xr-x
35.69 KB 2025-03-12 12:52 rwxr-xr-x
nroff — 3.21 KB
2022-02-01 10:44 · rwxr-xr-x
3.21 KB 2022-02-01 10:44 rwxr-xr-x
nslookup — 112.52 KB
2026-04-15 05:39 · rwxr-xr-x
112.52 KB 2026-04-15 05:39 rwxr-xr-x
nsupdate — 71.8 KB
2026-04-15 05:39 · rwxr-xr-x
71.8 KB 2026-04-15 05:39 rwxr-xr-x
numfmt — 55.83 KB
2025-03-12 12:52 · rwxr-xr-x
55.83 KB 2025-03-12 12:52 rwxr-xr-x
objcopy — 185.37 KB
2025-12-18 14:37 · rwxr-xr-x
185.37 KB 2025-12-18 14:37 rwxr-xr-x
objdump — 413.11 KB
2025-12-18 14:37 · rwxr-xr-x
413.11 KB 2025-12-18 14:37 rwxr-xr-x
od — 64.06 KB
2025-03-12 12:52 · rwxr-xr-x
64.06 KB 2025-03-12 12:52 rwxr-xr-x
odbc_config — 15.7 KB
2022-02-11 06:55 · rwxr-xr-x
15.7 KB 2022-02-11 06:55 rwxr-xr-x
odbcinst — 23.9 KB
2022-02-11 06:55 · rwxr-xr-x
23.9 KB 2022-02-11 06:55 rwxr-xr-x
openssl — 1.07 MB
2026-01-28 16:17 · rwxr-xr-x
1.07 MB 2026-01-28 16:17 rwxr-xr-x
optipng — 92.02 KB
2025-06-15 18:20 · rwxr-xr-x
92.02 KB 2025-06-15 18:20 rwxr-xr-x
pango-list — 19.11 KB
2023-04-07 10:19 · rwxr-xr-x
19.11 KB 2023-04-07 10:19 rwxr-xr-x
pango-segmentation — 19.13 KB
2023-04-07 10:19 · rwxr-xr-x
19.13 KB 2023-04-07 10:19 rwxr-xr-x
pango-view — 60.17 KB
2023-04-07 10:19 · rwxr-xr-x
60.17 KB 2023-04-07 10:19 rwxr-xr-x
passwd — 1.26 KB
2022-04-14 14:45 · rwxr-xr-x
1.26 KB 2022-04-14 14:45 rwxr-xr-x
paste — 35.58 KB
2025-03-12 12:52 · rwxr-xr-x
35.58 KB 2025-03-12 12:52 rwxr-xr-x
patch — 195.02 KB
2022-03-25 15:42 · rwxr-xr-x
195.02 KB 2022-03-25 15:42 rwxr-xr-x
pathchk — 35.66 KB
2025-03-12 12:52 · rwxr-xr-x
35.66 KB 2025-03-12 12:52 rwxr-xr-x
pdf2dsc — 701 B
2025-05-14 16:03 · rwxr-xr-x
701 B 2025-05-14 16:03 rwxr-xr-x
pdf2ps — 913 B
2025-05-14 16:03 · rwxr-xr-x
913 B 2025-05-14 16:03 rwxr-xr-x
perldoc — 118 B
2022-02-14 23:51 · rwxr-xr-x
118 B 2022-02-14 23:51 rwxr-xr-x
pgrep — 31.42 KB
2024-04-30 16:43 · rwxr-xr-x
31.42 KB 2024-04-30 16:43 rwxr-xr-x
php LINK — 10.1 MB
2026-08-23 15:25 · rwxr-xr-x
10.1 MB 2026-08-23 15:25 rwxr-xr-x
php-cgi LINK — 10.1 MB
2026-08-23 15:25 · rwxr-xr-x
10.1 MB 2026-08-23 15:25 rwxr-xr-x
phpize — 4.97 KB
2026-07-29 03:52 · rwxr-xr-x
4.97 KB 2026-07-29 03:52 rwxr-xr-x
pic — 201.72 KB
2022-02-01 10:44 · rwxr-xr-x
201.72 KB 2022-02-01 10:44 rwxr-xr-x
piconv — 8.08 KB
2022-02-11 16:42 · rwxr-xr-x
8.08 KB 2022-02-11 16:42 rwxr-xr-x
ping — 89.33 KB
2025-10-20 12:44 · rwxr-xr-x
89.33 KB 2025-10-20 12:44 rwxr-xr-x
pinky — 35.61 KB
2025-03-12 12:52 · rwxr-xr-x
35.61 KB 2025-03-12 12:52 rwxr-xr-x
pkill — 31.42 KB
2024-04-30 16:43 · rwxr-xr-x
31.42 KB 2024-04-30 16:43 rwxr-xr-x
pmap — 35.39 KB
2024-04-30 16:43 · rwxr-xr-x
35.39 KB 2024-04-30 16:43 rwxr-xr-x
pod2man — 14.68 KB
2022-03-25 12:10 · rwxr-xr-x
14.68 KB 2022-03-25 12:10 rwxr-xr-x
pod2text — 10.55 KB
2022-03-25 12:10 · rwxr-xr-x
10.55 KB 2022-03-25 12:10 rwxr-xr-x
pod2usage — 4.01 KB
2022-02-11 16:01 · rwxr-xr-x
4.01 KB 2022-02-11 16:01 rwxr-xr-x
post-grohtml — 199.76 KB
2022-02-01 10:44 · rwxr-xr-x
199.76 KB 2022-02-01 10:44 rwxr-xr-x
pr — 72.28 KB
2025-03-12 12:52 · rwxr-xr-x
72.28 KB 2025-03-12 12:52 rwxr-xr-x
pre-grohtml — 92.92 KB
2022-02-01 10:44 · rwxr-xr-x
92.92 KB 2022-02-01 10:44 rwxr-xr-x
precat — 5.53 KB
2019-10-08 00:15 · rwxr-xr-x
5.53 KB 2019-10-08 00:15 rwxr-xr-x
preunzip — 5.53 KB
2019-10-08 00:15 · rwxr-xr-x
5.53 KB 2019-10-08 00:15 rwxr-xr-x
prezip — 5.53 KB
2019-10-08 00:15 · rwxr-xr-x
5.53 KB 2019-10-08 00:15 rwxr-xr-x
prezip-bin — 15.69 KB
2022-01-26 21:47 · rwxr-xr-x
15.69 KB 2022-01-26 21:47 rwxr-xr-x
printenv — 31.47 KB
2025-03-12 12:52 · rwxr-xr-x
31.47 KB 2025-03-12 12:52 rwxr-xr-x
printf — 51.77 KB
2025-03-12 12:52 · rwxr-xr-x
51.77 KB 2025-03-12 12:52 rwxr-xr-x
ps — 141.15 KB
2024-04-30 16:43 · rwxr-xr-x
141.15 KB 2024-04-30 16:43 rwxr-xr-x
ps2ascii — 635 B
2025-05-14 16:03 · rwxr-xr-x
635 B 2025-05-14 16:03 rwxr-xr-x
ps2epsi — 1.24 KB
2025-05-14 16:03 · rwxr-xr-x
1.24 KB 2025-05-14 16:03 rwxr-xr-x
ps2pdf — 276 B
2025-05-14 16:03 · rwxr-xr-x
276 B 2025-05-14 16:03 rwxr-xr-x
ps2pdf12 — 219 B
2025-05-14 16:03 · rwxr-xr-x
219 B 2025-05-14 16:03 rwxr-xr-x
ps2pdf13 — 219 B
2025-05-14 16:03 · rwxr-xr-x
219 B 2025-05-14 16:03 rwxr-xr-x
ps2pdf14 — 219 B
2025-05-14 16:03 · rwxr-xr-x
219 B 2025-05-14 16:03 rwxr-xr-x
ps2pdfwr — 1.06 KB
2025-05-14 16:03 · rwxr-xr-x
1.06 KB 2025-05-14 16:03 rwxr-xr-x
ps2ps — 651 B
2025-05-14 16:03 · rwxr-xr-x
651 B 2025-05-14 16:03 rwxr-xr-x
ps2ps2 — 673 B
2025-05-14 16:03 · rwxr-xr-x
673 B 2025-05-14 16:03 rwxr-xr-x
ptx — 129.03 KB
2025-03-12 12:52 · rwxr-xr-x
129.03 KB 2025-03-12 12:52 rwxr-xr-x
pwd — 35.7 KB
2025-03-12 12:52 · rwxr-xr-x
35.7 KB 2025-03-12 12:52 rwxr-xr-x
pwdx — 15.28 KB
2024-04-30 16:43 · rwxr-xr-x
15.28 KB 2024-04-30 16:43 rwxr-xr-x
ranlib — 56 KB
2025-12-18 14:37 · rwxr-xr-x
56 KB 2025-12-18 14:37 rwxr-xr-x
readelf — 667.29 KB
2025-12-18 14:37 · rwxr-xr-x
667.29 KB 2025-12-18 14:37 rwxr-xr-x
readlink — 39.69 KB
2025-03-12 12:52 · rwxr-xr-x
39.69 KB 2025-03-12 12:52 rwxr-xr-x
realpath — 39.77 KB
2025-03-12 12:52 · rwxr-xr-x
39.77 KB 2025-03-12 12:52 rwxr-xr-x
recode — 31.93 KB
2022-11-02 11:35 · rwxr-xr-x
31.93 KB 2022-11-02 11:35 rwxr-xr-x
red — 92 B
2022-01-30 05:02 · rwxr-xr-x
92 B 2022-01-30 05:02 rwxr-xr-x
rename — 23.23 KB
2026-02-04 21:11 · rwxr-xr-x
23.23 KB 2026-02-04 21:11 rwxr-xr-x
renew-dummy-cert — 729 B
2026-01-28 16:17 · rwxr-xr-x
729 B 2026-01-28 16:17 rwxr-xr-x
renice — 15.16 KB
2026-02-04 21:11 · rwxr-xr-x
15.16 KB 2026-02-04 21:11 rwxr-xr-x
replace — 4.5 MB
2026-08-19 14:11 · rwxr-xr-x
4.5 MB 2026-08-19 14:11 rwxr-xr-x
reset LINK — 27.34 KB
2025-09-21 09:23 · rwxr-xr-x
27.34 KB 2025-09-21 09:23 rwxr-xr-x
restic LINK — 28.4 MB
2025-06-20 12:52 · rwx------
28.4 MB 2025-06-20 12:52 rwx------
rev — 15.16 KB
2026-02-04 21:11 · rwxr-xr-x
15.16 KB 2026-02-04 21:11 rwxr-xr-x
rm — 60.21 KB
2025-03-12 12:52 · rwxr-xr-x
60.21 KB 2025-03-12 12:52 rwxr-xr-x
rmdir — 43.61 KB
2025-03-12 12:52 · rwxr-xr-x
43.61 KB 2025-03-12 12:52 rwxr-xr-x
rnano LINK — 346.2 KB
2025-03-13 03:12 · rwxr-xr-x
346.2 KB 2025-03-13 03:12 rwxr-xr-x
rsync — 558.48 KB
2026-04-01 16:25 · rwxr-xr-x
558.48 KB 2026-04-01 16:25 rwxr-xr-x
rsync-ssl — 5.01 KB
2021-09-26 23:44 · rwxr-xr-x
5.01 KB 2021-09-26 23:44 rwxr-xr-x
run-with-aspell — 89 B
2022-01-26 21:47 · rwxr-xr-x
89 B 2022-01-26 21:47 rwxr-xr-x
runcon — 35.65 KB
2025-03-12 12:52 · rwxr-xr-x
35.65 KB 2025-03-12 12:52 rwxr-xr-x
rvi LINK — 1.38 MB
2026-04-29 09:50 · rwxr-xr-x
1.38 MB 2026-04-29 09:50 rwxr-xr-x
rview LINK — 1.38 MB
2026-04-29 09:50 · rwxr-xr-x
1.38 MB 2026-04-29 09:50 rwxr-xr-x
rvim LINK — 3.84 MB
2026-04-29 09:50 · rwxr-xr-x
3.84 MB 2026-04-29 09:50 rwxr-xr-x
scalar — 819.34 KB
2025-07-21 16:25 · rwxr-xr-x
819.34 KB 2025-07-21 16:25 rwxr-xr-x
scl — 39.55 KB
2023-04-07 01:57 · rwxr-xr-x
39.55 KB 2023-04-07 01:57 rwxr-xr-x
scl_enabled — 262 B
2021-07-27 15:14 · rwxr-xr-x
262 B 2021-07-27 15:14 rwxr-xr-x
scl_source — 1.88 KB
2021-07-27 15:14 · rwxr-xr-x
1.88 KB 2021-07-27 15:14 rwxr-xr-x
scp — 132.91 KB
2026-05-21 11:24 · rwxr-xr-x
132.91 KB 2026-05-21 11:24 rwxr-xr-x
script — 51.58 KB
2026-02-04 21:11 · rwxr-xr-x
51.58 KB 2026-02-04 21:11 rwxr-xr-x
sdiff — 44.2 KB
2022-01-29 18:15 · rwxr-xr-x
44.2 KB 2022-01-29 18:15 rwxr-xr-x
sed — 114.01 KB
2022-02-15 10:36 · rwxr-xr-x
114.01 KB 2022-02-15 10:36 rwxr-xr-x
seq — 47.79 KB
2025-03-12 12:52 · rwxr-xr-x
47.79 KB 2025-03-12 12:52 rwxr-xr-x
setsid — 15.15 KB
2026-02-04 21:11 · rwxr-xr-x
15.15 KB 2026-02-04 21:11 rwxr-xr-x
setterm — 35.33 KB
2026-02-04 21:11 · rwxr-xr-x
35.33 KB 2026-02-04 21:11 rwxr-xr-x
sftp — 157.09 KB
2026-05-21 11:24 · rwxr-xr-x
157.09 KB 2026-05-21 11:24 rwxr-xr-x
sh LINK — 1.32 MB
2024-04-30 14:33 · rwxr-xr-x
1.32 MB 2024-04-30 14:33 rwxr-xr-x
sha1sum — 39.64 KB
2025-03-12 12:52 · rwxr-xr-x
39.64 KB 2025-03-12 12:52 rwxr-xr-x
sha224sum — 39.64 KB
2025-03-12 12:52 · rwxr-xr-x
39.64 KB 2025-03-12 12:52 rwxr-xr-x
sha256sum — 39.64 KB
2025-03-12 12:52 · rwxr-xr-x
39.64 KB 2025-03-12 12:52 rwxr-xr-x
sha384sum — 39.64 KB
2025-03-12 12:52 · rwxr-xr-x
39.64 KB 2025-03-12 12:52 rwxr-xr-x
sha512sum — 39.64 KB
2025-03-12 12:52 · rwxr-xr-x
39.64 KB 2025-03-12 12:52 rwxr-xr-x
shred — 51.88 KB
2025-03-12 12:52 · rwxr-xr-x
51.88 KB 2025-03-12 12:52 rwxr-xr-x
shuf — 48.01 KB
2025-03-12 12:52 · rwxr-xr-x
48.01 KB 2025-03-12 12:52 rwxr-xr-x
size — 31.61 KB
2025-12-18 14:37 · rwxr-xr-x
31.61 KB 2025-12-18 14:37 rwxr-xr-x
skill — 31.4 KB
2024-04-30 16:43 · rwxr-xr-x
31.4 KB 2024-04-30 16:43 rwxr-xr-x
slabtop — 23.42 KB
2024-04-30 16:43 · rwxr-xr-x
23.42 KB 2024-04-30 16:43 rwxr-xr-x
sleep — 35.65 KB
2025-03-12 12:52 · rwxr-xr-x
35.65 KB 2025-03-12 12:52 rwxr-xr-x
slencheck — 15.71 KB
2022-02-11 06:55 · rwxr-xr-x
15.71 KB 2022-02-11 06:55 rwxr-xr-x
snice — 31.4 KB
2024-04-30 16:43 · rwxr-xr-x
31.4 KB 2024-04-30 16:43 rwxr-xr-x
soelim LINK — 0 B
1970-01-01 00:00 · ---------
0 B 1970-01-01 00:00 ---------
sort — 113.09 KB
2025-03-12 12:52 · rwxr-xr-x
113.09 KB 2025-03-12 12:52 rwxr-xr-x
spell — 125 B
2019-10-08 00:15 · rwxr-xr-x
125 B 2019-10-08 00:15 rwxr-xr-x
split — 52.31 KB
2025-03-12 12:52 · rwxr-xr-x
52.31 KB 2025-03-12 12:52 rwxr-xr-x
sprof — 35.45 KB
2026-08-03 10:14 · rwxr-xr-x
35.45 KB 2026-08-03 10:14 rwxr-xr-x
sqlite3 — 1.54 MB
2025-11-11 22:18 · rwxr-xr-x
1.54 MB 2025-11-11 22:18 rwxr-xr-x
ssh — 896.36 KB
2026-05-21 11:24 · rwxr-xr-x
896.36 KB 2026-05-21 11:24 rwxr-xr-x
ssh-add — 305.73 KB
2026-05-21 11:24 · rwxr-xr-x
305.73 KB 2026-05-21 11:24 rwxr-xr-x
ssh-agent — 317.7 KB
2026-05-21 11:24 · rwxr-xr-x
317.7 KB 2026-05-21 11:24 rwxr-xr-x
ssh-copy-id — 13.84 KB
2026-05-21 11:24 · rwxr-xr-x
13.84 KB 2026-05-21 11:24 rwxr-xr-x
ssh-keygen — 475.41 KB
2026-05-21 11:24 · rwxr-xr-x
475.41 KB 2026-05-21 11:24 rwxr-xr-x
ssh-keyscan — 338.26 KB
2026-05-21 11:24 · rwxr-xr-x
338.26 KB 2026-05-21 11:24 rwxr-xr-x
stat — 80.06 KB
2025-03-12 12:52 · rwxr-xr-x
80.06 KB 2025-03-12 12:52 rwxr-xr-x
stdbuf — 43.74 KB
2025-03-12 12:52 · rwxr-xr-x
43.74 KB 2025-03-12 12:52 rwxr-xr-x
strings — 31.74 KB
2025-12-18 14:37 · rwxr-xr-x
31.74 KB 2025-12-18 14:37 rwxr-xr-x
strip — 185.37 KB
2025-12-18 14:37 · rwxr-xr-x
185.37 KB 2025-12-18 14:37 rwxr-xr-x
stty — 75.83 KB
2025-03-12 12:52 · rwxr-xr-x
75.83 KB 2025-03-12 12:52 rwxr-xr-x
sum — 35.59 KB
2025-03-12 12:52 · rwxr-xr-x
35.59 KB 2025-03-12 12:52 rwxr-xr-x
svn — 445.38 KB
2025-09-22 13:45 · rwxr-xr-x
445.38 KB 2025-09-22 13:45 rwxr-xr-x
svnadmin — 135.74 KB
2025-09-22 13:45 · rwxr-xr-x
135.74 KB 2025-09-22 13:45 rwxr-xr-x
svndumpfilter — 43.48 KB
2025-09-22 13:45 · rwxr-xr-x
43.48 KB 2025-09-22 13:45 rwxr-xr-x
svnfsfs — 43.37 KB
2025-09-22 13:45 · rwxr-xr-x
43.37 KB 2025-09-22 13:45 rwxr-xr-x
svnlook — 91.56 KB
2025-09-22 13:45 · rwxr-xr-x
91.56 KB 2025-09-22 13:45 rwxr-xr-x
svnrdump — 55.57 KB
2025-09-22 13:45 · rwxr-xr-x
55.57 KB 2025-09-22 13:45 rwxr-xr-x
svnserve — 112.25 KB
2025-09-22 13:45 · rwxr-xr-x
112.25 KB 2025-09-22 13:45 rwxr-xr-x
svnsync — 67.74 KB
2025-09-22 13:45 · rwxr-xr-x
67.74 KB 2025-09-22 13:45 rwxr-xr-x
svnversion — 15.13 KB
2025-09-22 13:45 · rwxr-xr-x
15.13 KB 2025-09-22 13:45 rwxr-xr-x
sync — 35.54 KB
2025-03-12 12:52 · rwxr-xr-x
35.54 KB 2025-03-12 12:52 rwxr-xr-x
tabs — 19.16 KB
2025-09-21 09:23 · rwxr-xr-x
19.16 KB 2025-09-21 09:23 rwxr-xr-x
tac — 104.6 KB
2025-03-12 12:52 · rwxr-xr-x
104.6 KB 2025-03-12 12:52 rwxr-xr-x
tail — 68.09 KB
2025-03-12 12:52 · rwxr-xr-x
68.09 KB 2025-03-12 12:52 rwxr-xr-x
tar — 518.16 KB
2026-01-05 19:41 · rwxr-xr-x
518.16 KB 2026-01-05 19:41 rwxr-xr-x
taskset — 23.23 KB
2026-02-04 21:11 · rwxr-xr-x
23.23 KB 2026-02-04 21:11 rwxr-xr-x
tbl — 130.86 KB
2022-02-01 10:44 · rwxr-xr-x
130.86 KB 2022-02-01 10:44 rwxr-xr-x
tclsh LINK — 15.69 KB
2022-10-15 21:29 · rwxr-xr-x
15.69 KB 2022-10-15 21:29 rwxr-xr-x
tclsh8.6 — 15.69 KB
2022-10-15 21:29 · rwxr-xr-x
15.69 KB 2022-10-15 21:29 rwxr-xr-x
tee — 35.69 KB
2025-03-12 12:52 · rwxr-xr-x
35.69 KB 2025-03-12 12:52 rwxr-xr-x
test — 43.79 KB
2025-03-12 12:52 · rwxr-xr-x
43.79 KB 2025-03-12 12:52 rwxr-xr-x
tic — 87.79 KB
2025-09-21 09:23 · rwxr-xr-x
87.79 KB 2025-09-21 09:23 rwxr-xr-x
timeout — 40.17 KB
2025-03-12 12:52 · rwxr-xr-x
40.17 KB 2025-03-12 12:52 rwxr-xr-x
tload — 19.34 KB
2024-04-30 16:43 · rwxr-xr-x
19.34 KB 2024-04-30 16:43 rwxr-xr-x
tmpwatch LINK — 36.03 KB
2022-02-11 11:52 · rwxr-xr-x
36.03 KB 2022-02-11 11:52 rwxr-xr-x
toe — 23.23 KB
2025-09-21 09:23 · rwxr-xr-x
23.23 KB 2025-09-21 09:23 rwxr-xr-x
top — 132.27 KB
2024-04-30 16:43 · rwxr-xr-x
132.27 KB 2024-04-30 16:43 rwxr-xr-x
touch — 92.03 KB
2025-03-12 12:52 · rwxr-xr-x
92.03 KB 2025-03-12 12:52 rwxr-xr-x
tput — 27.25 KB
2025-09-21 09:23 · rwxr-xr-x
27.25 KB 2025-09-21 09:23 rwxr-xr-x
tr — 47.87 KB
2025-03-12 12:52 · rwxr-xr-x
47.87 KB 2025-03-12 12:52 rwxr-xr-x
tree — 85.45 KB
2022-02-12 01:46 · rwxr-xr-x
85.45 KB 2022-02-12 01:46 rwxr-xr-x
troff — 732.07 KB
2022-02-01 10:44 · rwxr-xr-x
732.07 KB 2022-02-01 10:44 rwxr-xr-x
true — 27.47 KB
2025-03-12 12:52 · rwxr-xr-x
27.47 KB 2025-03-12 12:52 rwxr-xr-x
truncate — 35.66 KB
2025-03-12 12:52 · rwxr-xr-x
35.66 KB 2025-03-12 12:52 rwxr-xr-x
tset — 27.34 KB
2025-09-21 09:23 · rwxr-xr-x
27.34 KB 2025-09-21 09:23 rwxr-xr-x
tsort — 47.79 KB
2025-03-12 12:52 · rwxr-xr-x
47.79 KB 2025-03-12 12:52 rwxr-xr-x
tty — 31.65 KB
2025-03-12 12:52 · rwxr-xr-x
31.65 KB 2025-03-12 12:52 rwxr-xr-x
tzselect — 14.99 KB
2026-08-03 10:11 · rwxr-xr-x
14.99 KB 2026-08-03 10:11 rwxr-xr-x
ul — 23.26 KB
2026-02-04 21:11 · rwxr-xr-x
23.26 KB 2026-02-04 21:11 rwxr-xr-x
uname — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
unexpand — 39.73 KB
2025-03-12 12:52 · rwxr-xr-x
39.73 KB 2025-03-12 12:52 rwxr-xr-x
uniq — 43.83 KB
2025-03-12 12:52 · rwxr-xr-x
43.83 KB 2025-03-12 12:52 rwxr-xr-x
unlink — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
unrar — 347.02 KB
2022-05-04 18:22 · rwxr-xr-x
347.02 KB 2022-05-04 18:22 rwxr-xr-x
unzip — 195.95 KB
2025-09-21 11:04 · rwxr-xr-x
195.95 KB 2025-09-21 11:04 rwxr-xr-x
unzipsfx — 87.7 KB
2025-09-21 11:04 · rwxr-xr-x
87.7 KB 2025-09-21 11:04 rwxr-xr-x
uptime — 15.29 KB
2024-04-30 16:43 · rwxr-xr-x
15.29 KB 2024-04-30 16:43 rwxr-xr-x
users — 35.68 KB
2025-03-12 12:52 · rwxr-xr-x
35.68 KB 2025-03-12 12:52 rwxr-xr-x
utmpdump — 23.21 KB
2026-02-04 21:11 · rwxr-xr-x
23.21 KB 2026-02-04 21:11 rwxr-xr-x
vdir — 137.65 KB
2025-03-12 12:52 · rwxr-xr-x
137.65 KB 2025-03-12 12:52 rwxr-xr-x
vi — 691 B
2026-04-29 09:50 · rwxr-xr-x
691 B 2026-04-29 09:50 rwxr-xr-x
view — 150 B
2026-04-29 09:50 · rwxr-xr-x
150 B 2026-04-29 09:50 rwxr-xr-x
vim — 3.84 MB
2026-04-29 09:50 · rwxr-xr-x
3.84 MB 2026-04-29 09:50 rwxr-xr-x
vimdiff LINK — 3.84 MB
2026-04-29 09:50 · rwxr-xr-x
3.84 MB 2026-04-29 09:50 rwxr-xr-x
vimtutor — 2.07 KB
2026-04-29 09:50 · rwxr-xr-x
2.07 KB 2026-04-29 09:50 rwxr-xr-x
vmstat — 39.41 KB
2024-04-30 16:43 · rwxr-xr-x
39.41 KB 2024-04-30 16:43 rwxr-xr-x
watch — 27.87 KB
2024-04-30 16:43 · rwxr-xr-x
27.87 KB 2024-04-30 16:43 rwxr-xr-x
wc — 43.73 KB
2025-03-12 12:52 · rwxr-xr-x
43.73 KB 2025-03-12 12:52 rwxr-xr-x
wget — 521.41 KB
2024-09-03 11:58 · rwxr-xr-x
521.41 KB 2024-09-03 11:58 rwxr-xr-x
whereis — 31.84 KB
2026-02-04 21:11 · rwxr-xr-x
31.84 KB 2026-02-04 21:11 rwxr-xr-x
which — 27.89 KB
2025-08-05 06:19 · rwxr-xr-x
27.89 KB 2025-08-05 06:19 rwxr-xr-x
who — 51.77 KB
2025-03-12 12:52 · rwxr-xr-x
51.77 KB 2025-03-12 12:52 rwxr-xr-x
whoami — 31.66 KB
2025-03-12 12:52 · rwxr-xr-x
31.66 KB 2025-03-12 12:52 rwxr-xr-x
word-list-compress — 15.7 KB
2022-01-26 21:47 · rwxr-xr-x
15.7 KB 2022-01-26 21:47 rwxr-xr-x
x86_64-redhat-linux-c++ — 1.05 MB
2025-09-15 15:46 · rwxr-xr-x
1.05 MB 2025-09-15 15:46 rwxr-xr-x
x86_64-redhat-linux-g++ — 1.05 MB
2025-09-15 15:46 · rwxr-xr-x
1.05 MB 2025-09-15 15:46 rwxr-xr-x
x86_64-redhat-linux-gcc-11 — 1.04 MB
2025-09-15 15:46 · rwxr-xr-x
1.04 MB 2025-09-15 15:46 rwxr-xr-x
xargs — 64.09 KB
2024-10-02 21:04 · rwxr-xr-x
64.09 KB 2024-10-02 21:04 rwxr-xr-x
xmlcatalog — 23.15 KB
2025-12-01 03:41 · rwxr-xr-x
23.15 KB 2025-12-01 03:41 rwxr-xr-x
xmllint — 80.56 KB
2025-12-01 03:41 · rwxr-xr-x
80.56 KB 2025-12-01 03:41 rwxr-xr-x
xmlwf — 39.63 KB
2025-11-26 16:14 · rwxr-xr-x
39.63 KB 2025-11-26 16:14 rwxr-xr-x
xsltproc — 31.23 KB
2026-03-31 15:37 · rwxr-xr-x
31.23 KB 2026-03-31 15:37 rwxr-xr-x
xxd — 19.32 KB
2026-04-29 09:50 · rwxr-xr-x
19.32 KB 2026-04-29 09:50 rwxr-xr-x
yes — 31.51 KB
2025-03-12 12:52 · rwxr-xr-x
31.51 KB 2025-03-12 12:52 rwxr-xr-x
zcat — 1.94 KB
2022-10-15 17:26 · rwxr-xr-x
1.94 KB 2022-10-15 17:26 rwxr-xr-x
zcmp — 1.64 KB
2022-10-15 17:26 · rwxr-xr-x
1.64 KB 2022-10-15 17:26 rwxr-xr-x
zdiff — 6.31 KB
2022-10-15 17:26 · rwxr-xr-x
6.31 KB 2022-10-15 17:26 rwxr-xr-x
zegrep — 33 B
2022-10-15 17:26 · rwxr-xr-x
33 B 2022-10-15 17:26 rwxr-xr-x
zfgrep — 33 B
2022-10-15 17:26 · rwxr-xr-x
33 B 2022-10-15 17:26 rwxr-xr-x
zforce — 2.04 KB
2022-10-15 17:26 · rwxr-xr-x
2.04 KB 2022-10-15 17:26 rwxr-xr-x
zgrep — 7.93 KB
2022-10-15 17:26 · rwxr-xr-x
7.93 KB 2022-10-15 17:26 rwxr-xr-x
zip — 221.09 KB
2023-04-07 14:02 · rwxr-xr-x
221.09 KB 2023-04-07 14:02 rwxr-xr-x
zipcloak — 75.7 KB
2023-04-07 14:02 · rwxr-xr-x
75.7 KB 2023-04-07 14:02 rwxr-xr-x
zipgrep — 2.89 KB
2008-10-10 17:40 · rwxr-xr-x
2.89 KB 2008-10-10 17:40 rwxr-xr-x
zipinfo — 195.95 KB
2025-09-21 11:04 · rwxr-xr-x
195.95 KB 2025-09-21 11:04 rwxr-xr-x
zipnote — 67.61 KB
2023-04-07 14:02 · rwxr-xr-x
67.61 KB 2023-04-07 14:02 rwxr-xr-x
zipsplit — 63.58 KB
2023-04-07 14:02 · rwxr-xr-x
63.58 KB 2023-04-07 14:02 rwxr-xr-x
zless — 2.16 KB
2022-10-15 17:26 · rwxr-xr-x
2.16 KB 2022-10-15 17:26 rwxr-xr-x
zmore — 1.8 KB
2022-10-15 17:26 · rwxr-xr-x
1.8 KB 2022-10-15 17:26 rwxr-xr-x
znew — 4.47 KB
2022-10-15 17:26 · rwxr-xr-x
4.47 KB 2022-10-15 17:26 rwxr-xr-x
zsoelim LINK — 0 B
1970-01-01 00:00 · ---------
0 B 1970-01-01 00:00 ---------
ONLINE
bin
468 items
20:45:25
TERMINAL FM
Edit
Preview
Download
Rename
Copy
Chmod
Delete
ELF>P@X @8 @@@@XX \0\0;KKh7GG88800hhhDDStd88800PtdPPPLLQtdRtd;KKp4p4/lib64/ld-linux-x86-64.so.2 GNUGNU;? GTI#3ViftGNU )fUa9[;.Pe!N7]B,H(he~'G?<>W_^k;PV!7Pf%x|{TjO.]xs%XzMd}_MH E ]GEhJpoDtIq 220\Q#gMQWAVt 2;$3 6/oC~Y)GYae.`jV;,2!x4)iD;EQDkUwNE'#/;P )R5;mS+QJBl&`9R=nXgC {T;IWHIo "Fvu7@0?NY] (-uGN Q4EIty!4Jd%aesPUZO|$ay*:Z)[&R|~k&CLs fT^/7J2 k@1n[Ls))9& z%;N5waVTRjh~pzNSmmg@PuKU`K4tmspxs32L Bk"I 2>l<1E-a~+ 94@*4L Q9';_3_?gS& r*UU !BNle|J}4!GQ#@|V$$>xz?P nFgT[U z08 ~pZ=d#yPxkEq_m4;M[4Iy<R=ahL_&(F")hk "@24&j 4U+w*MCI,S| B]rKXRr,r;jZWFM&ay/ rk(}.{SR<9Ah/o z9?;Sb"WBX> iI_Bb5xB4\b{U=/7I^vj`D@A@+`67\x[qi5w.,]+H1tn:VC*SruVM` T%{i :~%~W.9T@}&_\j*&!IAo4 ^>01Qj"&|U>g'S?(!DTs8^(t8! f.([z'Ă3 Gf[>imgs=*l.v .=xh`D~ OAzywR0ur-X2~Y\d`$eKevfC3 N)G?C}Muj] 5)@o+|L&gF\zFt[.tpcp`Z)ZIsC p~E`+:s`O0E/u1x.Zu{2-PMsNj$&hx?UX1RkMhJSnX> _C0>$#&Y~x 48-y@<0W/=X[MnE]R"ISGzi(7OW,U/0;+g YJcJ~E;cBVQ`d -%]2B fL_|~!U)#< [)-AK{r -v N{ T_' >D84I" 6FNVt1x$Ն1gVq&<8plA U$DHJ>MJ2@[]J#Cc6 j>HJ:iiqE/4a<V\v13-y);wY_jJtzNBs!F,x{AM_}w\<5P.F#y5OvdN^]H+ZS& zZ@HX-e/3 vfdBU<9^Gi2\z } 92 z^=6f*z#"UC0*- { k\ PW:;3;J 3N-GQ|fʅ{M"idq4F3Zp'f:zvCx 2L ?J0P1nORՀ,n5Y!wL_+K]Nzt?i  L%j+~ZO]yK0iJEfnw8g3Fi_EgE_+b(Fd#>/RQe%ZpOw3WXmJ^0 wOF*^]jH?TL /}L؅xN@oT\m\.Qq f>.] 95 P},EKPo_!K4\ig#D[ i7eXm2A+:j{Y2"C!XKp6f itO PH фKPvlBF̃n7kko2iaB'hY3\AQ2k  ZA9a*Me mB$ [llh:Oa=tP$ W.1P 3q Vk L/ QiV3eam&c/)YiyO`v U6&rJyur88^OCEK,>A|LJYuoV0*Pp`7o2q{8y5m@uZ{$ \UH.bMC cSebA&yCZ dB*!JxamSmE{m3y ix lrW86R)Tu?GC~JLkxm=TZHv%V<"OO:a 1o9-8@`e}>+\0.ڂ? pqkF_g}?a kOSx`1},kWw %}^n:Y'f"qy"0yyMM7O v}@~jYJoC~:c>w:zAj{]g q!)NmPXu!z0 1)3FS]F6 &lWGx4xgt+T ]&' ?dcDC3py6L/$zFX;c[Oa[/?ef}S|3Eb,[X;"TL&XKfn5@iRlesJ\ I 4/G%P*?'=Ieu:-To [(3D3a"Ud['Ձfo\DsOF wR',E6 %wg">!eB/q^WpH0;#Rg^61ts)#p]z1IJgCStn=҂-jV @txr+] nD6}&qv\# Z 2NqZ@{5r#5Kj>[* ` ebA/+|XD)}!#!"! a\- QVs~r MQ^_9Ad Vv)" I_G'M,n7],`DnL&8,})^pBDKgG.CNw9_z X{g,^O "r-R 1B vq), gbO  O7bE]eHui'`h?%Rp{bo2wo8Pi.0WnzH==<:cN0l@5~-yfwqK#e|P/l ~t`(78+H~h@W@c^k/@ PM`_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__cxa_finalize__libc_start_mainOSSL_CMP_SRV_CTX_get0_custom_ctxOSSL_CMP_MSG_get_bodytypeERR_newERR_set_debugERR_set_errorOSSL_CMP_MSG_dupOSSL_CMP_MSG_freeOPENSSL_sk_numOSSL_CMP_ITAV_freeOSSL_CMP_ITAV_dupOPENSSL_sk_deep_copyOPENSSL_sk_valueOSSL_CMP_ITAV_get0_typeOPENSSL_sk_new_reserveOBJ_obj2nidOSSL_CRMF_CERTTEMPLATE_newX509_get_issuer_nameOSSL_CRMF_CERTTEMPLATE_fillX509_ALGOR_newOBJ_nid2objX509_ALGOR_set0OSSL_CMP_ATAV_new_algIdOSSL_CMP_ATAV_new_rsaKeyLenOSSL_CMP_ATAV_push1OSSL_CRMF_ATTRIBUTETYPEANDVALUE_freeX509_ALGOR_freeOSSL_CRMF_CERTTEMPLATE_freeOSSL_CMP_ATAVS_freeOPENSSL_sk_freeOSSL_CMP_ITAV_get0_crlStatusListOSSL_CMP_CRLSTATUS_get0OSSL_CMP_ITAV_get0_rootCaCertX509_get_subject_nameX509_NAME_cmpOSSL_CMP_ITAV_new_rootCaKeyUpdateOPENSSL_sk_pushOSSL_CMP_ITAV_new_caCertsOSSL_CMP_ITAV_new_crlsX509_CRL_get0_lastUpdateASN1_TIME_compare__stack_chk_failOSSL_CMP_ITAV_new0_certReqTemplateX509_CRL_get_issuerX509_digest_sigASN1_OCTET_STRING_cmpASN1_OCTET_STRING_freeBIO_printfOSSL_CMP_snprint_PKIStatusInfoASN1_INTEGER_getASN1_STRING_print_exX509_get0_serialNumberASN1_INTEGER_cmpOSSL_CRMF_MSG_get0_regCtrl_oldCertIDOSSL_CRMF_CERTID_get0_serialNumberOSSL_CRMF_CERTID_get0_issuerX509_dupOSSL_CRMF_MSG_centralkeygen_requestedX509_chain_up_refOSSL_CMP_PKISI_dupOSSL_STACK_OF_X509_freeEVP_PKEY_dupOSSL_CMP_SRV_CTX_get0_cmp_ctxOSSL_CMP_CTX_set0_newPkeyEVP_PKEY_freeOSSL_CMP_STATUSINFO_newOSSL_CMP_MSG_get0_headerOSSL_CMP_HDR_get0_geninfo_ITAVsOSSL_CMP_ITAV_get0_certProfileASN1_STRING_get0_datastrcmpNCONF_get_stringOPENSSL_sk_new_nullBIO_freeERR_print_errorsBUF_MEM_freeCRYPTO_freeASN1_TYPE_freeOBJ_create_objectsstrtolASN1_ITEM_lookupBIO_putsASN1_ITEM_getBUF_MEM_newBUF_MEM_growBIO_readd2i_ASN1_TYPEASN1_TYPE_getBIO_writeASN1_item_d2iASN1_item_printASN1_item_freeNCONF_freeASN1_generate_nconfi2d_ASN1_TYPEASN1_tag2strPEM_read_bioBIO_f_base64BIO_newBIO_pushASN1_parse_dumpX509_NAME_onelineASN1_INTEGER_to_BNBN_is_zeroBN_bn2hexBN_freeTXT_DB_get_by_indexOPENSSL_strcasecmpCRYPTO_strdupASN1_GENERALIZEDTIME_set_stringX509_gmtime_adjstrlenCRYPTO_mallocOPENSSL_strlcpyOPENSSL_strlcatASN1_UTCTIME_freeX509_get0_notAftermemcpyTXT_DB_insertOBJ_txt2objASN1_OBJECT_freeX509_REVOKED_set_revocationDateX509_REVOKED_add1_ext_i2dASN1_GENERALIZEDTIME_freeASN1_ENUMERATED_freeASN1_TIME_freeASN1_ENUMERATED_newASN1_ENUMERATED_setBIO_free_allOPENSSL_cleanseTXT_DB_freeX509_CRL_freeENGINE_freeERR_set_markERR_clear_last_markBIO_new_fileASN1_STRING_set_default_mask_ascERR_pop_to_markERR_clear_errorperrorX509_check_private_keyASN1_TIME_set_string__ctype_b_loc__ctype_toupper_locASN1_TIME_newX509_time_adjEVP_PKEY_get_default_digest_nameX509V3_set_ctxX509V3_set_nconfX509V3_EXT_add_nconfBN_newNCONF_get_sectionCONF_loadX509_REQ_newX509_REQ_get_subject_nameOBJ_txt2nidNETSCAPE_SPKI_b64_decodeX509_NAME_add_entry_by_NIDX509_REQ_freeNETSCAPE_SPKI_freeX509_NAME_ENTRY_freeNETSCAPE_SPKI_get_pubkeyNETSCAPE_SPKI_verifyX509_REQ_set_pubkeyX509_get0_pubkeyX509_verifyX509_to_X509_REQBN_add_wordX509_printBIO_ctrlstdinfgetsPEM_write_bio_X509ASN1_STRING_lengthi2d_X509_bioX509_CRL_new_exX509_CRL_set_issuer_nameASN1_TIME_set_string_X509X509_CRL_set1_lastUpdateX509_CRL_set1_nextUpdateX509_REVOKED_newBN_hex2bnBN_to_ASN1_INTEGERX509_REVOKED_set_serialNumberASN1_INTEGER_freeX509_CRL_add0_revokedX509_CRL_sortX509_CRL_set_versionX509_time_adj_exX509_CRL_add1_ext_i2dEVP_MD_CTX_newEVP_MD_CTX_freeX509_CRL_sign_ctxPEM_write_bio_X509_CRLX509V3_EXT_CRL_add_nconfTXT_DB_writeOPENSSL_cipher_nameSSL_CTX_freeSSL_freeSSL_CTX_new_exSSL_CTX_ctrlSSL_CTX_set_ciphersuitesSSL_CTX_set_cipher_listSSL_newSSL_get1_supported_ciphersSSL_CIPHER_get_nameSSL_CIPHER_get_idSSL_CIPHER_descriptionSSL_CIPHER_standard_nameSSL_CTX_set_srp_client_pwd_callbackSSL_CTX_set_psk_client_callbackSSL_get_ciphersOSSL_CMP_print_to_bioX509_STORE_get0_paramX509_VERIFY_PARAM_set1_hostX509_VERIFY_PARAM_set1_ipX509_VERIFY_PARAM_set1_emailX509_VERIFY_PARAM_set_hostflagsX509_VERIFY_PARAM_set1_ip_ascOSSL_CMP_MSG_writeOSSL_CMP_MSG_readOSSL_CMP_CTX_server_performOSSL_CMP_HDR_get0_recipNonceOSSL_CMP_HDR_get0_transactionIDOSSL_CMP_CTX_set1_senderNonceOSSL_CMP_CTX_set1_transactionIDOSSL_CMP_MSG_http_performOSSL_CMP_MSG_update_transactionIDOSSL_CMP_MSG_update_recipNonceOSSL_CMP_MSG_get0_certreq_publickeyX509_PUBKEY_get0strchrASN1_TYPE_newOPENSSL_strncasecmpASN1_INTEGER_newASN1_INTEGER_setASN1_TYPE_setOSSL_CMP_ITAV_createOSSL_CMP_CTX_push0_geninfo_ITAVASN1_UTF8STRING_newASN1_STRING_setASN1_UTF8STRING_freeX509_up_refOSSL_CMP_PKISI_freeCRYPTO_clear_freeX509_STORE_add_certX509_STORE_CTX_print_verify_cbX509_STORE_set_verify_cbX509_STORE_set1_paramX509_STORE_freeX509_STORE_newOSSL_CMP_CTX_print_errorsOSSL_CMP_CTX_get0_untrustedSSL_CTX_newSSL_CTX_set_cert_storeSSL_CTX_set_verifySSL_CTX_use_certificateX509_VERIFY_PARAM_get_flagsX509_VERIFY_PARAM_clear_flagsX509_VERIFY_PARAM_set_flagsSSL_CTX_get0_certificateSSL_CTX_use_PrivateKeyOSSL_HTTP_parse_urlOSSL_CMP_CTX_set_optionBIO_snprintfOSSL_CMP_CTX_set1_server__strncat_chkOBJ_sn2nidOSSL_CMP_CTX_set1_serverPathOSSL_CMP_CTX_set1_untrustedOSSL_CMP_CTX_set1_srvCertOSSL_CMP_CTX_set0_trustedStoreOSSL_CMP_CTX_set_serverPortOSSL_CMP_CTX_set1_proxyOSSL_CMP_CTX_set1_no_proxyOSSL_HTTP_adapt_proxyOSSL_CMP_CTX_set_certConf_cb_argOSSL_CMP_CTX_set_transfer_cbCRYPTO_zallocOSSL_CMP_CTX_get_http_cb_argOSSL_CMP_CTX_set_http_cb_argOSSL_CMP_CTX_get_optionOSSL_CMP_CTX_set_http_cbOSSL_CMP_CTX_set1_secretValueOSSL_CMP_CTX_set1_referenceValueOSSL_CMP_CTX_set1_pkeyOSSL_CMP_CTX_set1_certOSSL_CMP_CTX_set1_extraCertsOutOBJ_ln2nidOSSL_CMP_CTX_set1_issuerOSSL_CMP_CTX_set1_subjectNames2i_ASN1_INTEGEROSSL_CMP_CTX_set1_serialNumberX509V3_EXT_add_nconf_skOSSL_CMP_CTX_set0_reqExtensionsOSSL_CMP_CTX_reqExtensions_have_SANOSSL_CMP_CTX_build_cert_chainOSSL_CMP_CTX_set1_p10CSRX509_EXTENSION_freeOPENSSL_sk_pop_freea2i_GENERAL_NAMEOSSL_CMP_CTX_push1_subjectAltNameGENERAL_NAME_freePOLICYINFO_newOSSL_CMP_CTX_push0_policyOSSL_CMP_CTX_set1_oldCertOSSL_CMP_CTX_set1_recipientOSSL_CMP_CTX_set1_expected_senderOSSL_CMP_ITAV_new0_certProfileASN1_STRING_freePOLICYINFO_freeBIO_s_fileunlink__errno_locationX509_add_certi2t_ASN1_OBJECTOPENSSL_dieOSSL_CMP_MSG_itOSSL_CMP_CTX_get_statusOSSL_sleepBIO_s_memOBJ_nid2lnOSSL_CMP_ATAV_get0_typeOSSL_CMP_ATAV_get_rsaKeyLenOSSL_CMP_ATAV_get0_algIdX509_ALGOR_get0i2a_ASN1_OBJECTX509_ALGOR_itOBJ_nid2snCMS_ContentInfo_new_exCMS_ContentInfo_freePEM_read_bio_CMSd2i_CMS_bioSMIME_read_CMS_exX509_STORE_CTX_get_errorGENERAL_NAME_printGENERAL_NAMES_newGENERAL_NAMES_freeX509_VERIFY_PARAM_newX509_VERIFY_PARAM_freeCMS_ReceiptRequest_freeEVP_CIPHER_freeEVP_MD_freeOPENSSL_hexstr2bufCMS_add1_signerCMS_SignerInfo_get0_pkey_ctxCMS_add1_ReceiptRequestCMS_get1_certsCMS_data_create_exEVP_aes_256_cbcCMS_digest_create_exASN1_PCTX_newASN1_PCTX_set_flagsASN1_PCTX_set_str_flagsASN1_PCTX_set_nm_flagsCMS_ContentInfo_print_ctxASN1_PCTX_freei2d_CMS_bio_streamPEM_write_bio_CMS_streamSMIME_write_CMSCMS_get0_SignerInfosCMS_sign_receiptCMS_encrypt_exCMS_add1_recipientCMS_RecipientInfo_get0_pkey_ctxEVP_CIPHER_get_nidEVP_PKEY_CTX_ctrlCMS_RecipientInfo_typeCMS_RecipientInfo_kari_get0_ctxEVP_EncryptInit_exCMS_add0_recipient_keyCMS_add0_recipient_passwordCMS_finalERR_peek_errorCMS_EncryptedData_encrypt_exCMS_dataCMS_EncryptedData_decryptCMS_uncompressCMS_digest_verifyCMS_verify_receiptCMS_verifyCMS_get0_signersCMS_ReceiptRequest_get0_valuesBIO_dump_indentCMS_get1_ReceiptRequestCMS_decrypt_set1_keyCMS_decrypt_set1_pkey_and_peerCMS_decrypt_set1_passwordCMS_decryptCMS_sign_exCMS_set1_eContentTypeCMS_ReceiptRequest_create0_exCMS_compressCMS_final_digestEVP_sha1X509_STORE_CTX_freeX509_CRL_diffX509_NAME_hash_oldX509_LOOKUP_fileX509_STORE_add_lookupX509_STORE_CTX_newX509_STORE_CTX_initX509_STORE_CTX_get_obj_by_subjectX509_OBJECT_get0_X509X509_get_pubkeyX509_OBJECT_freeX509_CRL_verifyX509_CRL_get0_nextUpdateASN1_TIME_print_exX509_NAME_hash_exX509_CRL_get_ext_d2ii2a_ASN1_INTEGERX509_CRL_digestEVP_MD_get0_nameX509_CRL_get0_signatureX509_CRL_print_exi2d_X509_CRL_bioPKCS7_freePKCS7_newPKCS7_SIGNED_newPEM_X509_INFO_read_bioOPENSSL_sk_shiftX509_INFO_freePEM_read_bio_X509_CRLd2i_X509_CRL_bioPEM_write_bio_PKCS7i2d_PKCS7_biostrstrEVP_MD_fetchEVP_get_digestbynameEVP_DigestSignFinalEVP_DigestVerifyFinalEVP_DigestFinalXOFBIO_getsEVP_DigestSignEVP_DigestVerifyOBJ_NAME_do_all_sortedBIO_f_mdEVP_PKEY_CTX_freeEVP_PKEY_new_raw_private_keyEVP_DigestVerifyInitEVP_PKEY_get0_type_nameBIO_debug_callback_exBIO_set_callback_exBIO_set_callback_argEVP_DigestInit_exEVP_DigestSignInitEVP_DigestVerifyInit_exEVP_DigestSignInit_exEVP_PKEY_get_sizeEVP_sha256EVP_MD_xofEVP_MD_CTX_get1_mdEVP_PKEY_get_bn_paramOSSL_PARAM_freeOSSL_PARAM_BLD_freeOSSL_PARAM_BLD_newOSSL_PARAM_BLD_push_BNOSSL_PARAM_BLD_to_paramEVP_PKEY_CTX_new_from_nameEVP_PKEY_fromdata_initEVP_PKEY_fromdataEVP_PKEY_CTX_set_app_dataEVP_PKEY_paramgen_initEVP_PKEY_CTX_set_dsa_paramgen_bitsOSSL_ENCODER_CTX_new_for_pkeyOSSL_ENCODER_to_bioOSSL_ENCODER_CTX_freeOSSL_DECODER_CTX_new_for_pkeyOSSL_DECODER_from_bioOSSL_DECODER_CTX_freeEVP_PKEY_is_aEVP_PKEY_CTX_set_dh_paramgen_prime_lenEVP_PKEY_CTX_set_dh_paramgen_generatorEVP_PKEY_CTX_set_cbEVP_PKEY_CTX_new_from_pkeyEVP_PKEY_param_checkEVP_PKEY_print_paramsEVP_PKEY_print_privateOSSL_ENCODER_CTX_get_num_encodersEVP_CIPHER_get0_nameOSSL_ENCODER_CTX_set_cipherOSSL_ENCODER_CTX_set_passphrase_uiOSSL_ENCODER_CTX_set_passphraseOSSL_PARAM_construct_intOSSL_ENCODER_CTX_set_paramsBN_printEVP_PKEY_print_publicEVP_PKEY_CTX_set_dsa_paramgen_q_bitsEVP_PKEY_keygen_initPEM_write_bio_PrivateKeyi2d_KeyParams_bioPEM_write_bio_Parametersi2d_PrivateKey_bio__memcpy_chkOSSL_CMP_CTX_newOSSL_CMP_CTX_set_log_cbOSSL_CMP_CTX_get_transfer_cb_argOSSL_CMP_SRV_CTX_freeOSSL_CMP_CTX_get_certConf_cb_argOSSL_CMP_CTX_freeOSSL_CMP_log_closeaccessUI_nullOSSL_CMP_exec_RR_sesOSSL_CMP_CTX_snprint_PKIStatusOSSL_CMP_CTX_get0_validatedSrvCertOSSL_CMP_CTX_get1_extraCertsInOSSL_CMP_CTX_get1_newChainOSSL_CMP_CTX_get1_caPubsOSSL_CMP_CTX_reinitOSSL_CMP_exec_certreqOSSL_CMP_CTX_push0_genm_ITAVOSSL_CMP_exec_GENM_sesOSSL_CMP_SRV_CTX_newOSSL_CMP_PKISI_newOSSL_CMP_SRV_CTX_initOSSL_CMP_SRV_CTX_init_transEVP_PKEY_up_refX509_CRL_up_refOSSL_CMP_CTX_get0_newPkeyEVP_CIPHER_fetchOSSL_CMP_get1_certReqTemplateOSSL_CMP_get1_crlUpdateOSSL_CMP_get1_rootCaKeyUpdatei2d_OSSL_CRMF_CERTTEMPLATEASN1_i2d_bioi2d_OSSL_CMP_ATAVSOSSL_CMP_get1_caCertsOSSL_CMP_CTX_set_transfer_cb_argOSSL_CMP_SRV_CTX_set_accept_raverifiedOSSL_CMP_SRV_CTX_set_accept_unprotectedOSSL_CMP_SRV_CTX_set_send_unprotected_errorsOSSL_CMP_SRV_CTX_set_grant_implicit_confirmX509_NAME_freeEVP_PKEY_set_utf8_string_paramEVP_PKEY_set_int_paramEVP_PKEY_checkOSSL_PARAM_construct_utf8_stringOSSL_PARAM_construct_endEVP_PKEY_CTX_set_paramsEVP_PKEY_keygenEVP_PKEY_set_octet_string_paramEC_get_builtin_curvesEVP_default_properties_is_fips_enabledEVP_get_cipherbynameEVP_CIPHER_get_flagsEVP_CIPHER_get_modememsetOPENSSL_hexchar2intEVP_CIPHER_get_key_lengthEVP_CIPHER_get_iv_lengthPKCS5_PBKDF2_HMACEVP_SKEYMGMT_freeEVP_SKEY_freeEVP_read_pw_stringBIO_new_fpBIO_f_zlibEVP_BytesToKeyBIO_f_cipherEVP_SKEYMGMT_fetchEVP_SKEYMGMT_get0_imp_settable_paramsEVP_SKEYMGMT_get0_nameEVP_SKEY_importEVP_CipherInit_SKEYBIO_number_readBIO_number_writtenEVP_CIPHER_CTX_set_flagsEVP_CipherInit_exBIO_set_flagsEVP_CIPHER_CTX_set_paddingRAND_bytes__printf_chkputcharstrcpyCRYPTO_reallocOSSL_STORE_LOADER_get0_engineOSSL_STORE_LOADER_get0_schemeENGINE_by_idENGINE_get_nameENGINE_get_idENGINE_ctrlENGINE_get_RSAENGINE_get_ECENGINE_get_DSAENGINE_get_DHENGINE_get_RANDENGINE_get_ciphersENGINE_initENGINE_finishENGINE_get_digestsENGINE_get_pkey_methsENGINE_get_firstENGINE_get_nextOSSL_STORE_do_all_loadersstdoutERR_print_errors_fpOPENSSL_init_ssl__isoc99_sscanfERR_error_string_nEVP_PKEY_get_bitsOPENSSL_infoEVP_KDF_freeEVP_KDF_CTX_freeEVP_KDF_fetchEVP_KDF_CTX_newEVP_KDF_settable_ctx_paramsEVP_KDF_CTX_set_paramsEVP_KDF_deriveOPENSSL_buf2hexstrOSSL_PROVIDER_get0_nameEVP_CIPHER_get0_providerEVP_CIPHER_up_refOPENSSL_sk_newEVP_CIPHER_do_all_providedOPENSSL_sk_sortEVP_CIPHER_is_aEVP_CIPHER_names_do_allEVP_CIPHER_get0_descriptionEVP_CIPHER_gettable_paramsEVP_CIPHER_gettable_ctx_paramsEVP_CIPHER_settable_ctx_paramsEVP_CIPHER_do_all_sortedEVP_MD_get0_providerEVP_MD_up_refEVP_MD_do_all_providedEVP_MD_is_aEVP_MD_names_do_allEVP_MD_get0_descriptionEVP_MD_gettable_paramsEVP_MD_gettable_ctx_paramsEVP_MD_settable_ctx_paramsEVP_MD_do_all_sortedEVP_MAC_get0_providerEVP_MAC_get0_nameEVP_MAC_fetchEVP_MAC_freeEVP_MAC_up_refEVP_MAC_do_all_providedEVP_MAC_is_aEVP_MAC_names_do_allEVP_MAC_get0_descriptionEVP_MAC_gettable_paramsEVP_MAC_gettable_ctx_paramsEVP_MAC_settable_ctx_paramsEVP_KDF_get0_providerEVP_KDF_get0_nameEVP_KDF_up_refEVP_KDF_do_all_providedEVP_KDF_is_aEVP_KDF_names_do_allEVP_KDF_get0_descriptionEVP_KDF_gettable_paramsEVP_KDF_gettable_ctx_paramsEVP_RAND_get0_nameEVP_RAND_get0_providerEVP_RAND_fetchEVP_RAND_freeEVP_RAND_up_refEVP_RAND_CTX_get0_randEVP_RAND_get_stateEVP_RAND_gettable_ctx_paramsEVP_RAND_CTX_get_paramsOSSL_PARAM_get_uint64OSSL_PARAM_get_int64OSSL_ENCODER_get0_providerOSSL_ENCODER_get0_nameOSSL_ENCODER_fetchOSSL_ENCODER_freeOSSL_ENCODER_up_refOSSL_ENCODER_do_all_providedOSSL_ENCODER_is_aOSSL_ENCODER_names_do_allOSSL_ENCODER_get0_propertiesOSSL_ENCODER_get0_descriptionOSSL_ENCODER_settable_ctx_paramsOSSL_DECODER_get0_providerOSSL_DECODER_get0_nameOSSL_DECODER_fetchOSSL_DECODER_freeOSSL_DECODER_up_refOSSL_DECODER_do_all_providedOSSL_DECODER_is_aOSSL_DECODER_names_do_allOSSL_DECODER_get0_propertiesOSSL_DECODER_get0_descriptionOSSL_DECODER_settable_ctx_paramsEVP_KEYMGMT_get0_providerEVP_KEYMGMT_get0_nameEVP_KEYMGMT_fetchEVP_KEYMGMT_freeEVP_KEYMGMT_up_refEVP_KEYMGMT_do_all_providedEVP_KEYMGMT_is_aEVP_KEYMGMT_names_do_allEVP_KEYMGMT_get0_descriptionEVP_KEYMGMT_gen_settable_paramsEVP_KEYMGMT_settable_paramsEVP_KEYMGMT_gettable_paramsEVP_SKEYMGMT_get0_providerEVP_SKEYMGMT_up_refEVP_SIGNATURE_get0_providerEVP_SIGNATURE_get0_nameEVP_SIGNATURE_fetchEVP_SIGNATURE_freeEVP_SIGNATURE_up_refEVP_SIGNATURE_do_all_providedEVP_SIGNATURE_is_aEVP_SIGNATURE_names_do_allEVP_SIGNATURE_get0_descriptionEVP_SIGNATURE_settable_ctx_paramsEVP_SIGNATURE_gettable_ctx_paramsOSSL_PARAM_locate_constOSSL_PROVIDER_get_capabilitiesEVP_KEM_get0_providerEVP_KEM_get0_nameEVP_KEM_fetchEVP_KEM_freeEVP_KEM_up_refEVP_KEM_do_all_providedEVP_KEM_is_aEVP_KEM_names_do_allEVP_KEM_get0_descriptionEVP_KEM_settable_ctx_paramsEVP_KEM_gettable_ctx_paramsEVP_ASYM_CIPHER_get0_providerEVP_ASYM_CIPHER_get0_nameEVP_ASYM_CIPHER_fetchEVP_ASYM_CIPHER_freeEVP_ASYM_CIPHER_up_refEVP_ASYM_CIPHER_do_all_providedEVP_ASYM_CIPHER_is_aEVP_ASYM_CIPHER_names_do_allEVP_ASYM_CIPHER_get0_descriptionEVP_ASYM_CIPHER_settable_ctx_paramsEVP_ASYM_CIPHER_gettable_ctx_paramsEVP_KEYEXCH_get0_providerEVP_KEYEXCH_get0_nameEVP_KEYEXCH_fetchEVP_KEYEXCH_freeEVP_KEYEXCH_up_refEVP_KEYEXCH_do_all_providedEVP_KEYEXCH_is_aEVP_KEYEXCH_names_do_allEVP_KEYEXCH_get0_descriptionEVP_KEYEXCH_settable_ctx_paramsEVP_KEYEXCH_gettable_ctx_paramsENGINE_get_digest_engineENGINE_get_cipher_engineOSSL_STORE_LOADER_get0_providerOSSL_STORE_LOADER_up_refOSSL_STORE_LOADER_freeOSSL_STORE_LOADER_do_all_providedOSSL_STORE_LOADER_is_aOSSL_STORE_LOADER_names_do_allEVP_RAND_do_all_providedEVP_RAND_get0_descriptionEVP_RAND_gettable_paramsEVP_RAND_settable_ctx_paramsRAND_get0_primaryRAND_get0_publicRAND_get0_privateEVP_SKEYMGMT_do_all_providedEVP_SKEYMGMT_is_aEVP_SKEYMGMT_names_do_allEVP_SKEYMGMT_get0_descriptionSSL_get1_builtin_sigalgsOSSL_PROVIDER_do_allTLS_methodOBJ_new_nidOBJ_obj2txtOSSL_PARAM_construct_utf8_ptrOSSL_PARAM_set_all_unmodifiedOSSL_PROVIDER_get_paramsOSSL_PARAM_modifiedOSSL_PROVIDER_gettable_paramsEVP_PKEY_meth_get_countEVP_PKEY_meth_get0EVP_PKEY_meth_get0_infoEVP_PKEY_asn1_get_countEVP_PKEY_asn1_get0EVP_PKEY_asn1_get0_infoEVP_PKEY_CTX_new_idPEM_read_bio_Parameters_exEVP_PKEY_CTX_newEVP_PKEY_CTX_settable_paramsstrerrori2d_PUBKEY_bioPEM_write_bio_PUBKEYBN_GENCB_newBN_GENCB_freeEVP_PKEY_CTX_set_rsa_keygen_bitsBN_set_wordEVP_PKEY_CTX_set1_rsa_keygen_pubexpEVP_PKEY_CTX_set_rsa_keygen_primesPEM_write_bio_PrivateKey_traditionalBN_bn2decEVP_MAC_CTX_freeEVP_MAC_CTX_newEVP_MAC_CTX_set_paramsEVP_MAC_initEVP_MAC_updateEVP_MAC_finalNETSCAPE_CERT_SEQUENCE_freeNETSCAPE_CERT_SEQUENCE_newPEM_read_bio_X509PEM_read_bio_NETSCAPE_CERT_SEQUENCEPEM_write_bio_NETSCAPE_CERT_SEQUENCEstrncmpOPENSSL_LH_retrieveOPENSSL_LH_strhashqsortOPENSSL_LH_newOPENSSL_LH_set_thunksOPENSSL_LH_insertPKCS12_SAFEBAG_get0_attrsX509_ATTRIBUTE_createX509at_add1_attrPKCS12_SAFEBAG_set0_attrsX509_ATTRIBUTE_freePKCS12_freeOSSL_PROVIDER_availableX509_STORE_CTX_new_exX509_verify_certX509_STORE_CTX_get1_chainX509_add_certsX509_alias_set1EVP_PKEY_add1_attr_by_NIDPKCS12_create_ex2PKCS12_set_maci2d_PKCS12_bioPKCS12_init_exd2i_PKCS12_bioPKCS12_get0_macPKCS12_verify_macPKCS12_unpack_authsafesPKCS12_unpack_p7encdataPKCS12_SAFEBAG_freePKCS12_unpack_p7dataEVP_des_ede3_cbcX509_keyid_set1OPENSSL_sk_deletePKCS12_mac_presentX509_verify_cert_error_stringPKCS12_set_pbmac1_pbkdf2PBMAC1_get1_pbkdf2_paramPBKDF2PARAM_freeOPENSSL_asc2uniOPENSSL_uni2utf8PKCS7_new_exPEM_read_bio_PKCS7d2i_PKCS7_bioPKCS7_print_ctxX509_SIG_freePKCS8_PRIV_KEY_INFO_freed2i_PKCS8_PRIV_KEY_INFO_bioEVP_PKCS82PKEYEVP_PBE_findd2i_PKCS8_bioPKCS8_decryptEVP_PKEY2PKCS8PEM_read_bio_PKCS8PEM_read_bio_PKCS8_PRIV_KEY_INFOPKCS5_pbe2_set_ivPKCS8_set0_pbei2d_PKCS8_PRIV_KEY_INFO_bioi2d_PKCS8_bioPEM_write_bio_PKCS8_PRIV_KEY_INFOPKCS5_pbe_setPKCS5_pbe2_set_scryptPEM_write_bio_PKCS8EVP_PKEY_set_paramsEVP_PKEY_public_checkEVP_PKEY_encryptEVP_PKEY_decapsulateEVP_PKEY_signEVP_PKEY_deriveEVP_PKEY_decryptEVP_PKEY_verify_recoverEVP_PKEY_encapsulateEVP_DigestVerifyUpdateEVP_DigestSignUpdateEVP_PKEY_verify_initEVP_PKEY_CTX_get0_pkeyEVP_PKEY_derive_set_peerEVP_PKEY_CTX_ctrl_strEVP_PKEY_encrypt_initEVP_PKEY_decapsulate_initEVP_PKEY_CTX_set_kem_opEVP_PKEY_derive_initEVP_MD_CTX_set_pkey_ctxEVP_PKEY_verifyEVP_PKEY_decrypt_initEVP_PKEY_sign_initBIO_dumpEVP_PKEY_verify_recover_initEVP_PKEY_encapsulate_initBN_generate_prime_exBN_check_primeBN_dec2bnstrtoulreadlinkOCSP_RESPONSE_itOCSP_REQUEST_itASN1_item_i2d_mem_bioOSSL_HTTP_transferASN1_item_d2i_bioOCSP_REQUEST_freeOCSP_RESPONSE_freeOCSP_BASICRESP_freeX509V3_conf_freeX509V3_add_valueX509_get0_pubkey_bitstrOCSP_cert_id_newOCSP_request_add0_idOCSP_cert_to_idOCSP_REQUEST_newopenlogsetpgidsignalwaitpid__syslog_chkOCSP_request_signOCSP_REQUEST_printi2d_OCSP_REQUESTOCSP_request_onereq_countOCSP_BASICRESP_newOCSP_request_onereq_get0OCSP_onereq_get0_idOCSP_id_get0_infoOCSP_id_issuer_cmpOCSP_CERTID_freeOCSP_copy_nonceOCSP_basic_sign_ctxOCSP_response_createi2d_OCSP_RESPONSEOCSP_response_statusOCSP_basic_add1_statusOCSP_SINGLERESP_add1_ext_i2dOCSP_response_status_strOCSP_RESPONSE_printOCSP_request_add1_nonceOCSP_RESPONSE_newd2i_OCSP_RESPONSEASN1_d2i_bioforkd2i_OCSP_REQUEST_exitRAND_pollOCSP_response_get1_basicOCSP_check_nonceOCSP_basic_verifyOCSP_check_validityOCSP_cert_status_strASN1_GENERALIZEDTIME_printOCSP_crl_reason_strOCSP_resp_find_statusOCSP_resp_get0_signaturestderrOPENSSL_LH_freeRAND_write_fileOSSL_LIB_CTX_freeOSSL_STORE_unregister_loaderUI_destroy_methodUI_OpenSSLUI_create_methodUI_method_set_openerOSSL_STORE_LOADER_newOSSL_STORE_LOADER_set_opengetenvCONF_get1_default_config_fileUI_method_set_readerUI_method_set_writerUI_method_set_closerUI_method_set_prompt_constructorOSSL_STORE_LOADER_set_expectOSSL_STORE_LOADER_set_loadOSSL_STORE_LOADER_set_eofOSSL_STORE_LOADER_set_errorOSSL_STORE_LOADER_set_closeOSSL_STORE_register_loaderOSSL_LIB_CTX_newEVP_md5EVP_DigestUpdateEVP_DigestFinal_exOPENSSL_uni2ascOPENSSL_DIR_readOPENSSL_DIR_endlstatstrrchrX509_digest__memset_chksymlinkEVP_MD_get_sizeX509_get_default_cert_dir_envstrtokX509_get_default_cert_dirEVP_PKEY_get0_RSAi2b_PublicKey_bioPEM_write_bio_RSA_PUBKEYi2d_RSA_PUBKEY_bioPEM_write_bio_RSAPublicKeyi2d_RSAPublicKey_bioEVP_PKEY_CTX_set_rsa_paddingSSL_SESSION_up_refSSL_SESSION_get0_cipherSSL_CIPHER_get_handshake_digestSSL_SESSION_freeSSL_CIPHER_findSSL_SESSION_newSSL_SESSION_set1_master_keySSL_SESSION_set_cipherSSL_SESSION_set_protocol_versionSSL_get_servernameSSL_get_servername_typeSSL_session_reusedSSL_select_next_protoPEM_write_bioPEM_write_bio_SSL_SESSIONSSL_SESSION_printOPENSSL_LH_doallX509_print_exPEM_write_bio_X509_REQ_NEWOPENSSL_LH_errorNCONF_get_number_ePEM_read_bio_ParametersCRYPTO_strndupOSSL_PARAM_construct_size_tEVP_PKEY_CTX_is_afilenoisattyX509V3_EXT_REQ_add_nconfX509_REQ_set_subject_nameX509_REQ_get0_pubkeyPEM_write_bio_X509_REQi2d_X509_REQ_bioX509_new_exX509_set_serialNumberX509_set_issuer_nameX509_set_subject_nameX509_set_pubkeyX509_add1_ext_i2dX509_get_serialNumberX509V3_set_issuer_pkeyX509_REQ_new_exX509_REQ_set_versionX509_REQ_print_exX509_NAME_add_entry_by_txtX509_NAME_entry_countX509_REQ_add1_attr_by_txtX509_REQ_add1_attr_by_NIDSSL_ctrlSSL_key_updateSSL_stream_concludeSSL_is_quicSSL_set_connect_stateSSL_get_fdBIO_closesocketSSL_renegotiateSSL_get_SSL_CTXSSL_get_current_cipherSSL_CIPHER_get_versionSSL_get_versionSSL_get_current_compressionSSL_get_current_expansionSSL_COMP_get_nameSSL_get_wbioSSL_get_rbioSSL_get0_next_proto_negotiatedSSL_get0_alpn_selectedSSL_get_selected_srtp_profileSSL_get_sessionSSL_export_keying_materialSSL_get_early_data_statusSSL_get_verify_resultSSL_get_peer_cert_chainX509_NAME_print_exEVP_PKEY_get_idX509_get_signature_nidX509_get0_notBeforeASN1_TIME_printSSL_get0_peer_certificateSSL_get_negotiated_client_cert_typeSSL_get_negotiated_server_cert_typeEVP_PKEY_get_group_nameEVP_PKEY_get_base_idSSL_get0_peer_rpkSSL_ct_is_enabledSSL_get0_peer_sctsSSL_CTX_get0_ctlog_storeSCT_validation_status_stringSCT_printSSL_CONF_CTX_newSSL_CONF_CTX_set_flagsBIO_ADDR_freeSSL_CONF_CTX_freeOSSL_QUIC_client_methodDTLS_client_methodBIO_parse_hostservSSL_CTX_configSSL_CTX_set_default_read_buffer_lenSSL_CTX_set_tlsext_max_fragment_lengthSSL_add_file_cert_subjects_to_stackSSL_CTX_set0_CA_listSSL_CTX_set_client_cert_enginePEM_read_bio_SSL_SESSIONSSL_CTX_set_psk_use_session_callbackSSL_CTX_set_tlsext_use_srtpSSL_CTX_set_cert_cbSSL_CTX_set_next_proto_select_cbSSL_CTX_set_alpn_protosSSL_CTX_add_client_custom_extSSL_CTX_enable_ctSSL_CTX_set_ctlog_list_fileSSL_CTX_set_srp_usernameSSL_CTX_set_srp_cb_argSSL_CTX_set_srp_strengthSSL_CTX_set_srp_verify_param_callbackSSL_CTX_dane_enableSSL_CTX_sess_set_new_cbSSL_set_sessionSSL_dane_enableSSL_dane_tlsa_addSSL_set1_server_cert_typeBIO_sock_initBIO_lookup_exBIO_ADDRINFO_socktypeBIO_ADDRINFO_familyBIO_ADDRINFO_nextSSL_dane_set_flagsBIO_ADDRINFO_protocolBIO_socketBIO_ADDRINFO_addressBIO_bindBIO_connectBIO_ADDR_dupBIO_ADDR_hostname_stringBIO_ADDRINFO_freeBIO_new_dgramBIO_ADDR_newBIO_sock_infoSSL_set_optionsSSL_set_msg_callbackSSL_set_bioOSSL_HTTP_proxy_connectBIO_f_bufferBIO_popstrncpySSL_SESSION_get_max_early_dataSSL_is_init_finished__fdelt_chkselectSSL_handle_eventsSSL_readSSL_get_errorSSL_writeBIO_read_exSSL_write_early_dataSSL_get_key_update_typeSSL_get_event_timeoutSSL_net_write_desiredSSL_has_pendingSSL_net_read_desiredNCONF_newNCONF_load_bioASN1_get_objectSSL_CTX_callback_ctrlSSL_callback_ctrlBIO_new_socketBIO_socket_nbioSSL_set_blocking_modeSSL_set1_initial_peer_addrBIO_new_dgram_sctpSSL_traceBIO_f_nbio_testBIO_s_nullSSL_CTX_set_info_callbackSSL_CTX_set_default_ctlog_list_fileSSL_set1_client_cert_typeSSL_set_post_handshake_authSSL_CTX_set1_paramSSL_CTX_set_optionsSSL_is_dtlsSSL_set_SSL_CTXSSL_get_certificateX509_get1_ocspSSL_CTX_get_cert_storeX509_email_freeOCSP_REQUEST_add_extSSL_has_matching_session_idBIO_get_callback_argBIO_f_sslBIO_int_ctrlSSL_set_session_id_contextSSL_set_accept_stateBIO_test_flagsBIO_get_retry_reasonBUF_reverseSSL_get_shared_ciphersSSL_get_optionsSSL_clearSSL_read_early_dataSSL_waiting_for_asyncSSL_statelessSSL_acceptSSL_set_verifySSL_verify_client_post_handshakeSSL_do_handshakeDTLSv1_listenfstatSSL_sendfileSSL_SESSION_get_idi2d_SSL_SESSIONCRYPTO_memdupd2i_SSL_SESSION_exSSL_CTX_sess_set_get_cbSSL_CTX_sess_set_remove_cbSSL_CTX_set_generate_session_idSSL_CTX_set_next_protos_advertised_cbSSL_CTX_set_alpn_select_cbSSL_CTX_set0_tmp_dh_pkeySSL_CTX_use_serverinfo_fileSSL_CTX_set_psk_server_callbackSSL_CTX_use_psk_identity_hintSSL_CTX_set_psk_find_session_callbackSSL_CTX_set_session_id_contextSSL_CTX_set_cookie_generate_cbSSL_CTX_set_cookie_verify_cbSSL_CTX_set_stateless_cookie_generate_cbSSL_CTX_set_stateless_cookie_verify_cbSRP_VBASE_newSRP_VBASE_initSSL_CTX_set_srp_username_callbackSSL_CTX_set_max_early_dataSSL_CTX_set_recv_max_early_dataDTLS_server_methodSSL_CTX_set1_client_cert_typeBIO_listenBIO_ADDR_rawportBIO_sock_should_retryBIO_accept_exBIO_set_tcp_ndelaySSL_load_client_CA_fileSSL_CTX_set_client_CA_listSSL_CTX_set_not_resumable_session_callbackSSL_CTX_set1_server_cert_typeSSL_CTX_compress_certsBIO_s_connectSSL_connectsetsockoptSSL_CTX_set_quiet_shutdownSSL_CTX_use_certificate_fileSSL_CTX_use_PrivateKey_fileSSL_CTX_check_private_keytimesSSL_set_shutdownfputcfflushsysconfSSL_SESSION_get0_peerSSL_SESSION_set1_id_contextd2i_SSL_SESSIONSSL_SESSION_print_keylogEVP_SKEYMGMT_get0_gen_settable_paramsEVP_SKEY_generateEVP_SKEY_get0_key_idEVP_SKEY_get0_provider_nameEVP_SKEY_get0_skeymgmt_namePKCS7_sign_add_signerPKCS7_verifyPKCS7_get0_signersPKCS7_encrypt_exi2d_PKCS7_bio_streamSMIME_read_PKCS7_exPKCS7_sign_exPKCS7_add_certificateSMIME_write_PKCS7PKCS7_decryptPKCS7_finalPEM_write_bio_PKCS7_streamEVP_CipherEVP_EncryptFinal_exEVP_EncryptUpdateEVP_DecryptFinal_exEVP_DecryptUpdateEVP_CIPHER_CTX_ctrlEVP_DecryptInit_exalarmEVP_DigestInitEVP_CIPHER_CTX_newEVP_CIPHER_CTX_freeEVP_CIPHER_CTX_set_key_lengthEVP_CIPHER_CTX_get0_cipherEVP_CIPHER_CTX_get_block_sizeASYNC_start_jobASYNC_WAIT_CTX_get_all_fdsERR_peek_last_errorEVP_PKEY_CTX_set_ec_paramgen_curve_nidEVP_PKEY_paramgenERR_get_errorASYNC_is_capableASYNC_WAIT_CTX_freeASYNC_cleanup_threadASYNC_WAIT_CTX_newmlockASYNC_init_threadEVP_CIPHER_CTX_get_key_lengthEVP_CIPHER_CTX_rand_keyfwrite__fprintf_chkpipefdopenstrtodfclosewaitOpenSSL_versionBN_optionsOSSL_PARAM_construct_octet_stringd2i_PrivateKeyCRYPTO_memcmpEVP_PKEY_newEVP_PKEY_CTX_set_dh_nidBN_bin2bnOSSL_PARAM_construct_uintSRP_create_verifierBIO_vprintfa2i_ASN1_INTEGERTS_RESP_CTX_set_status_infoTS_RESP_CTX_add_failure_infoOSSL_PROVIDER_unloadOSSL_PROVIDER_add_conf_parameterASN1_OCTET_STRING_newASN1_OCTET_STRING_setX509_set0_distinguishing_idX509_REQ_set0_distinguishing_idX509_get_extension_flagsX509_cmp_timeframeX509_POLICY_NODE_printX509_get0_extensionsX509V3_EXT_nconfX509_EXTENSION_get_objectX509v3_get_ext_by_OBJX509v3_get_extX509_EXTENSION_get_dataX509_delete_extX509_add_extX509_VERIFY_PARAM_get0_hostBIO_ssl_shutdownOSSL_PROVIDER_loadOSSL_PROVIDER_set_default_search_pathRAND_load_fileSSL_CTX_load_verify_storeSSL_CTX_load_verify_fileSSL_CTX_load_verify_dirSSL_CTX_set_default_verify_fileSSL_CTX_set_default_verify_storeSSL_CTX_set_default_verify_dirsetbufBIO_new_fdNCONF_new_exOBJ_createEVP_DigestFinalOSSL_STORE_open_exOSSL_STORE_eofOSSL_STORE_loadOSSL_STORE_INFO_get_typeOSSL_STORE_INFO_get1_PUBKEYOSSL_STORE_INFO_freeOSSL_STORE_INFO_get1_PARAMSOSSL_STORE_INFO_get1_CRLOSSL_STORE_INFO_get1_CERTOSSL_STORE_INFO_get1_PKEYOSSL_STORE_closeOSSL_STORE_INFO_type_stringOSSL_STORE_expectOSSL_STORE_attachX509_load_httpX509_STORE_set_flagsX509_STORE_CTX_set0_trusted_stackX509_STORE_CTX_set0_crlsX509_STORE_CTX_get_num_untrustedX509_NAME_print_ex_fpX509_CRL_load_httpGENERAL_NAME_get0_valueX509_STORE_CTX_get_current_certX509_get_ext_d2iDIST_POINT_freeX509_REQ_get_extensionsX509_get_ext_by_OBJX509_STORE_CTX_get_error_depthX509_LOOKUP_storeX509_LOOKUP_ctrl_exX509_LOOKUP_hash_dirX509_LOOKUP_ctrlBN_randTXT_DB_create_indexX509_STORE_CTX_get0_policy_treeX509_STORE_CTX_get_explicit_policyX509_policy_tree_get0_policiesX509_policy_tree_get0_user_policiesX509_STORE_CTX_get0_parent_ctxX509_set_versionX509_sign_ctxX509_REQ_sign_ctxX509_REQ_verify_exBIO_f_prefixOSSL_STORE_errorOSSL_STORE_INFO_get0_PKEYOSSL_STORE_INFO_get0_PUBKEYOSSL_STORE_INFO_get0_PARAMSOSSL_STORE_INFO_get0_CRLOSSL_STORE_INFO_get0_NAMEOSSL_STORE_INFO_get0_NAME_descriptionOSSL_STORE_INFO_get0_CERTX509_CRL_printOSSL_STORE_supports_searchOSSL_STORE_findOSSL_STORE_SEARCH_by_nameOSSL_STORE_SEARCH_freeOSSL_STORE_SEARCH_by_issuer_serialOSSL_STORE_SEARCH_by_aliasOSSL_STORE_SEARCH_by_key_fingerprintNETSCAPE_SPKI_newNETSCAPE_SPKI_set_pubkeyNETSCAPE_SPKI_signNETSCAPE_SPKI_b64_encodeNETSCAPE_SPKI_printCONF_modules_loadd2i_TS_REQ_bioTS_REQ_to_TS_VERIFY_CTXTS_VERIFY_CTX_add_flagsTS_VERIFY_CTX_set0_storeTS_VERIFY_CTX_set0_certsTS_REQ_freeTS_RESP_verify_tokenTS_RESP_freeTS_VERIFY_CTX_freeTS_REQ_print_bioPKCS7_to_TS_TST_INFOTS_RESP_newTS_STATUS_INFO_newTS_STATUS_INFO_set_statusTS_RESP_set_status_infoTS_TST_INFO_freeTS_STATUS_INFO_freeTS_CONF_get_tsa_sectionTS_RESP_CTX_newTS_CONF_set_serialTS_CONF_set_crypto_deviceTS_CONF_set_signer_certTS_CONF_set_certsTS_CONF_set_signer_keyTS_RESP_CTX_set_signer_digestTS_CONF_set_ess_cert_id_digestTS_CONF_set_def_policyTS_CONF_set_policiesTS_CONF_set_digestsTS_CONF_set_accuracyTS_CONF_set_clock_precision_digitsTS_CONF_set_orderingTS_CONF_set_tsa_nameTS_CONF_set_ess_cert_id_chainTS_RESP_create_responseTS_RESP_CTX_freeTS_RESP_get_tst_infoTS_TST_INFO_print_bioTS_RESP_get_tokeni2d_TS_REQ_bioTS_REQ_newTS_REQ_set_versionTS_MSG_IMPRINT_newEVP_MD_get_typeTS_MSG_IMPRINT_set_algoTS_MSG_IMPRINT_set_msgTS_REQ_set_msg_imprintTS_REQ_set_policy_idTS_REQ_set_nonceTS_REQ_set_cert_reqTS_MSG_IMPRINT_freed2i_TS_RESP_bioi2d_TS_RESP_bioTS_VERIFY_CTX_newTS_VERIFY_CTX_set0_dataTS_VERIFY_CTX_set0_imprintTS_RESP_set_tst_infoTS_RESP_verify_responseTS_RESP_print_bioTS_CONF_set_signer_digestTXT_DB_readSRP_get_default_gNPEM_read_bio_X509_REQd2i_X509_REQ_bioSSL_get_all_async_fdsOSSL_PARAM_allocate_from_textRAND_statusX509V3_parse_listX509_PURPOSE_get0X509_PURPOSE_get0_nameX509_PURPOSE_get0_snameX509_PURPOSE_get_countX509_VERIFY_PARAM_get0X509_VERIFY_PARAM_get0_nameX509_VERIFY_PARAM_get_countX509_STORE_set_lookup_crlsX509_getm_notBeforeX509_getm_notAfterX509_STORE_set_default_paths_exX509_add1_trust_objectX509_add1_reject_objectX509_get_ext_countX509_get_extX509_reject_clearX509_trust_clearOBJ_cmpX509_check_hostX509_check_emailX509_check_ip_ascPEM_write_bio_X509_AUXX509_cmp_timeX509_ocspid_printX509_subject_name_hash_oldX509_issuer_name_hash_oldX509_issuer_name_hashX509_check_purposeX509_PURPOSE_get_idX509_alias_get0X509_subject_name_hashX509V3_extensions_printX509_get1_emailX509_get0_signatureX509_STORE_CTX_set_flagsX509_REQ_add_extensionsUI_method_get_openerUI_get_input_flagsUI_get0_user_dataUI_get_string_typeUI_method_get_readerUI_set_resultUI_method_get_writerUI_method_get_closerUI_construct_prompt__strncpy_chkOSSL_STORE_INFO_new_PKEYENGINE_load_private_keyENGINE_load_public_keyOSSL_STORE_INFO_new_PUBKEYSSL_alert_desc_string_longSSL_alert_type_string_longSSL_state_string_longBIO_ADDR_rawaddressEVP_Q_macSSL_certs_clearSSL_check_chainSSL_use_certificateSSL_use_PrivateKeyEC_curve_nid2nistEVP_PKEY_get0_asn1EVP_PKEY_CTX_get_app_dataEVP_PKEY_CTX_get_keygen_infoSSL_get_srp_NSSL_get_srp_gSRP_check_known_gN_paramBN_num_bitsBN_CTX_newBN_is_oddBN_CTX_freeBN_rshift1BN_mod_expBN_cmpSSL_set_srp_server_paramSRP_user_pwd_freeSSL_get_srp_usernameSSL_is_serverSSL_get_shared_sigalgsSSL_get_sigalgsX509_ATTRIBUTE_countX509_ATTRIBUTE_get0_objectX509_ATTRIBUTE_get0_typeENGINE_ctrl_cmdENGINE_set_defaultENGINE_register_all_completeENGINE_ctrl_cmd_stringkillOSSL_trace_enabledOSSL_trace_beginOSSL_trace_endASN1_item_i2dASN1_item_i2d_biostrtoimaxX509_VERIFY_PARAM_set_auth_levelX509_VERIFY_PARAM_set_timeX509_VERIFY_PARAM_set_depthX509_VERIFY_PARAM_lookupX509_VERIFY_PARAM_set1X509_PURPOSE_get_by_snameX509_VERIFY_PARAM_set_purposeX509_VERIFY_PARAM_add0_policystrtoumaxSSL_get0_peernameSSL_get0_dane_authoritySSL_get0_dane_tlsaSSL_CONF_CTX_set_ssl_ctxSSL_CONF_cmdSSL_CONF_CTX_finishX509_STORE_add_crlX509_STORE_load_storeX509_STORE_load_fileX509_STORE_load_pathSSL_CTX_get_security_callbackSSL_CTX_set_security_callbackSSL_CTX_set0_security_ex_dataSSL_CTX_set_keylog_callbackSSL_get0_peer_CA_listgetpidBIO_ADDR_service_stringBIO_s_acceptSSL_shutdownUI_new_methodUI_ctrlUI_add_user_dataUI_add_input_stringUI_add_verify_stringUI_processUI_freeEVP_DigestEVP_DigestInit_ex2SRP_VBASE_get1_by_userEVP_sha512EVP_PKEY_asn1_find_strENGINE_get_pkey_asn1_meth_strrenameASN1_UTCTIME_newASN1_UTCTIME_set_stringASN1_GENERALIZEDTIME_newX509_NAME_newX509_NAME_get_entryX509_NAME_ENTRY_get_dataX509_NAME_ENTRY_get_objectASN1_PRINTABLE_typeASN1_UNIVERSALSTRING_to_stringX509_NAME_dupX509_NAME_get_index_by_OBJX509_NAME_add_entryASN1_TIME_diffX509_NAME_delete_entryX509_NAME_get_index_by_NIDASN1_STRING_cmpEVP_PKEY_missing_parametersEVP_PKEY_copy_parametersX509_REQ_check_private_keyEVP_PKEY_get_utf8_string_paramSSL_group_to_nameSSL_get_peer_signature_type_nidBIO_new_mem_bufPBEPARAM_itASN1_item_unpackPBEPARAM_freePBE2PARAM_itPBE2PARAM_freePBKDF2PARAM_itSCRYPT_PARAMS_itSCRYPT_PARAMS_freePKCS12_SAFEBAG_get_nidPKCS12_SAFEBAG_get0_safesPKCS12_SAFEBAG_get0_p8infPKCS8_pkey_get0_attrsPKCS12_SAFEBAG_get0_attrPKCS12_SAFEBAG_get_bag_nidPKCS12_SAFEBAG_get1_certPKCS12_SAFEBAG_get0_bag_typePKCS12_SAFEBAG_get0_bag_objPKCS12_decrypt_skeyPKCS12_SAFEBAG_get0_typePKCS12_SAFEBAG_get0_pkcs8X509_SIG_get0libssl.so.3libcrypto.so.3libc.so.6OPENSSL_3.4.0OPENSSL_3.2.0OPENSSL_3.0.0GLIBC_2.15GLIBC_2.4GLIBC_2.7GLIBC_2.33GLIBC_2.14GLIBC_2.34GLIBC_2.3GLIBC_2.2.5GLIBC_2.3.4OPENSSL_3.0.9OPENSSL_3.0.3OPENSSL_3.3.0OPENSSL_3.5.0                               c@ /p -p +p ~ii ii LJч܇ ii ui ti o)+p#+p " .p 0 0p > /p -p +pK0KKKKK8K0KKhKXKK8L0L(LL( L (LP0L8L@LHLPLXL`LhLpLHxLLLLLL@L0LLLLLLhLL LLMMMM` M(M0M8M@MHMxPMXXMP`MHhM@pMpxMhM`MMM8MM MMMMMMHM@MMMXNpNNN N(N0Nx8NP@N HNPNXN`NhNpNxNNHN@N8N0N(N NNNNNNNNNNOOOO O(O0O8O@OHOPOXO`OhOpOxOO܊ O_ O^ OJ OIOJ OQ O(K P Pt P (PpK 0P @PK HP XPK `P pPL xP P`L P PL P PM P PHM P PM P QM Q QN Q 0Q@N 8Q HQN PQZ `QN hQ xQO Q QhO Q QO Q QO Q Q@P Q QP Q RP R R Q (R 8RpQ @R PRQ XR+ hRQ pR R0R R0 RpR R4 RR R@ RS RQ R@S R RS S. SS Sa (SS 0S @S0T HSj XS`T `S pST xS ST SKS@U S SU SzV SU Sr SV S T`V T T| T3 0TV 8T HTV PT `THW hT xTW T TW T T(X T TxX T TX T TY T U`Y U UY (Ut 8UY @U PU XUD hUZ pU U`Z U UZ U U[ U UP[ U U[ U U[ V V8\ V+ (V\ 0V6 @V\ HVD XV] `VO pVh] xV V] V V] V V@^ VZ V^ Vb V^ Vi W_ W W8_ W 0WX_ 8Wn HW_ PWH`W_ hW xW8` W Wx` Wp W` WjW` Wl W0a WjWpa WlXa X Xb (X 8XXb @X| PXb XX hX pX0_ Xb X X(c XpV Xpc X Xc X Xc X X@d Y Y Y (Yd 0Y @Yd HY XYe `Y pY0e xY Y Y Y`e Y Ye Y Y Y8 Ye YA Zf ZJ ZPf ZR 0Zf 8Z^ HZf PZh `Zg hZ xZXg Zt Zg Z Zg Z} Zg Z Z8h Z Zh Z [h [ [i ([ 8[@i @[ P[i X[ h[i p[ [j [ [ [j [Hj [ [j [ [j [ [ k \ \ \ (\pk 0\( @\k H\4 X\k `\@ p\l x\N \Xl \W \l \` \l \ \(m \h \`m \t ]m ]| ]m ] 0]n 8] H]@n P] `]n h] x]n ] ]o ] ]`o ] ]o ] ]o ]no]0p ] ^xp ^ ^p (^ 8^p @^ P^(q X^, h^`q p^ ^q ^ ^q ^< ^8r ^O ^pr ^a ^r ^ ^s _ _r _ (_ 0_ @_ H_ X_ `_ p_s x_ _ _ _  _7 _D _X _b _{ _(s _ ` ` `Ps ` 0` 8` H` P` ``xs h` x`s `! `s `- `t `9 `F `c `n `} `0t ` a a aXt (a 8a @a Pat Xa ha pa at a+ a a9 at aG au bS bY b (bw 0b܊ @b_ Hb Xbh `b5 pb@u xbg b b b b bhu b bu b\b b+e c cFe cu cee 0cu 8ce Hcu Pc `cv hcNxc8v c chv c c c cd c cd c ce c d0e dP d6^(ds\ 8dv `d hd  pd xd& d9 dD dY di d) d! d dw d d e e 8e Pe he e e e e e e f (f @f& Xf0 fS fv f fw f܊ f_ f fv g` gw g9 (g@ 0gX @gY Hgs Xg0w `gz pgpw xgܒ gw g gw g gx g} g g g0x g hhx h hx h 0hx 8h Hh Ph^ `h hh[ xhx hIh h h h h h h y h hHy h" ixy i iy (i0 8iy @iX Piz Xi? hiJ piz iPz ib il i iz il iz i i{ i i j j@{ j (jl 0jir @jh{ Hj? Xj `jpV pj{ xjn j{ jjj| jHj j0_ j`| j j| j#t k| k k| k 0k 8k Hk PkH`k} hkz xkP} k k k8 k} k@ k$ kK k} kT k~ kc lH~ lu l~ (l 8l~ @l Pl  Xl hl@ pl l` l l l l l l`e l le l l m md m (md 0m @me Hm Xm0e `mP pm6^xm m m mw m܊ m_ m n n n ns 0n 8nX Hn Pnܒ `n hn xn n! n( nkn9 nS n n\ n@ n nh nc o ok o (ou 8oz @o Po Xo ho powU o o o o o oS o0 o pw p܊ p_ (p 8p` @p Pps XpX hp pps p p ph pܒ p p p p pב p p q q q` (q 0q @q Hq Xq `q pq`e xq qe q q q qd q qd q qe q r0e rP r6^ r% 0r 8r- Hrн r rw r܊ r_ r$O r6 rK r( rV rX r_ sh s s` (s 8ss @sX Ps Xss hs ps s sn s s sh sܒ s s s s s̒ t t tAm (t 0t @tؾ Ht Xt `t pt xt td t td t te t t0e uS u u (uw 0u܊ @u_ HuJ Xu `u8 pu8 xu u` u us uX u us uA u uh uܒ v v vZ v 0vh 8v Hv Pve`v hvmqxv vv v v v` v v v v v`e v we w w (w 8wd @w Pwd Xw hwe pw w0e wP w6^w% wX wS w w xw x܊ x_ (x܄ 8xt @x Px` Xx hx pxn x x xh x x xp x xܒ x8 xpV x` yޅ y y (y 0y @y HyU Xy“ `yXa py“ xy yl y 0Z @L H Xf `w p x~       @  p      0 8 H P `d h xd  e  0e S X ܊ _  w (X 8 @ܒ P X^ hx p  _ Sʕ  xJ a k    l Ȇir ؆ t  k   8 (Ș 8 @Θ Pט X h p     @  ȇ` Ї(  >  S   (f 0t @X H X `} p x     0  ЈX ؈Ș     ƙ  0 8 H P ` h x    h   ȉ ؉   F " h : (h 8E @Z PR X hZ p @     m Ȋ Њ s  r    ( 0 @ H Xs ` p x   7 D X b { Ћ(s ؋   Ps    0 8 Hxs P `s h! xs - t 9 F c n Ȍ} ،0t    Xt   ( 8t @ P X ht p+  9 t G u  w ܊ _ X ` (n 8 @ P X%T h p 8  h s 0w  Ȏ Ўj /T 7T pV  ܒ (DT 0 @@ HaT Xp ` p x     w hT Џ ؏Z H T pT zV T X 0T 8z HT PV `p hZ xT K  x R T ȐY ؐ T  U $U  5U AU (YU 8 @l P( XiU h` ppU yU   @V  Am ȑU Б  U   @ U (h 0U @ HU X ` pU xU  U  ? z b ВPz ؒ 0  V x V  .V 0 8 H#V P:V ` hGV x@   l  #t  ȓw ؓ $O P  NV Q  (aV 8 @hV P XnV h pxV P V    V Ȕ ДV  V V V 8 V (` 0V @ H X ` p`e x e  x    Еd ؕ d  e  0e @ Pw X܊ h_ p h oV }V U ȖW ЖDr W 6 5W  LW  ( 0p @eW Hp XW `5 pW x W S ЗX ؗ w ܊ _  x  0 8 Hx P `W ht x0  0  P   Ș ؘ     D h (W 8 @W P XW h p s  r    ș Й   s    (  07 @D HX Xb `{ p(s x   Ps    К ؚ xs  s ! s - 0t 89 HF Pc `n h} x0t    Xt   ț ؛t    t +  (9 8t @G Pu X h| p   d  d  Ȝe М 0e P 6^HH @ Pw X܊ h_ p^ X I  x  ȝ Нt X CX /X  IX  (dX 0 @}X HD XX `X pX xX X n  $O ?  ОX ؞ Y X p Y jY 7Y 0AY 8HH\Y PX ` h xxY kY Y Y Y Y ȟY ؟Y ܒ   Y   ( 8`e @ Pe X hs p r      Ƞ Р s      7 (D 0X @b H{ X(s ` p x Ps      Сxs ء s ! s - t 9 0F 8c Hn P} `0t h x  Xt    t Ȣ آ  t +  9 t (G 8u @ P X hd p d  e  0e S Z  w ܊ _ ($O 8? @ Px X hZ p^X -Z kJZ _Z dZ Z ȤyZ ФK zV  Z 0 T (Z 0p @Z H Xs `n p x h ܒ DT  `  ХZ إ   d  d  0e 8 H0e PP `6^huU xZ S   Ȧw Ц܊ _  Z ^  [ ( 0 @x H X[ `>t p[ x/[  6[  ܄ =[  Ч اH[ Q[ jh l[ P n 0 8 H P ` h x`e  e    d Ȩ بd  e  0e P 6^(`8x ` pw x܊ _ u[   x  Щs ةX  j pV { n 0 8}[ H[ P `[ h xh j ܒ   [ Ȫ@V ت[ k[    d ( 8d @ Pe X h0e S 8  ȫw Ы܊ _ [  [  ([ 0 \ @ H Xx ` pH x\ p \  ^ x  Ь%\ ج9\   =\ Y\ ^\ S0 8z\ H P\ `\ h| xX  \ \ x 4v  ȭ ح \     `e ( 8e @ P X hd p d  e  0e P Ȯ6^Юv @ S X  (w 0܊ @_ HX X `s p xܒ     @ pV Я د x 1  : ( 8 0@ 8^ Hx P `[ h_x Sʕ c Yc  hc 0 ec (` 0tc @ Hc X `c pc x+e c Fe c ee c e c c d d  d #d 4d 0r `, ` , Fr , Mr  - [r H-  qr  x- r 0 - 8 lr H vr P nr ` - h r x r r r r . S H.   w  ܊ _ (  8 s @ X P r X  h h. p s r  h `  s )s s /s 7s  Ls qs  ds   ( . 0 @ . H vs X . ` ]qp {s x s /    `e  e    d    d  0 e 8  H 0e P P ` 6^h  x 8/  w ܊ _ s `/  ƙ    ( 0 @ H X ` p x s  / s / 0 s 00 w h0 Qq s 00 8s H0 P `1 ht x01 s X1 s s  t 1 t 1 ]n 1 n 2 t 82 (t 8h2 @"t P2 Xfh*t pBt 2 $O 3  Gt a Xt x 83 j ft  t  (P 0 @W H XW `ܒ pt x t Y t Y `3 t 3 t 3 u 3  3 u 0u 85u H?u P[u `du hu x 4 u X4 u 4 u 4 u 4 u u u  5 H P5 (zV 85 @u P5 X/T h5 p 6 u 86 Kv v v  s  r    ( 0 @ H Xs ` p x   7 D X b { (s    Ps    0 8 Hxs P `s h! xs - t 9 F c n } 0t    Xt   ( 8t @ P X ht p+  9 t G u    d  d  e  (0e ` pw x܊ _  s X   h  "\ "(> ("| 8"w| @"| P"X> X"| h"> p"| "| "| " } "%} "3} "M} "> "I} "> "ee "? #e #X? #X} (#b} 0#} @#} H#y X#} `#W p#? x#} #? # # # #d # #d # #e # $0e $S 0$J 8$ H$w P$܊ `$_ h$h x$? $s\ $xv $j$v $l$r $ $ @ $o $P@ $ %h %ܒ %8 (% 8%6 @% P% X% h%d p% %d % %e % %0e %P %6^%v % & &w &܊ (&_ 0& @&h H& X&x@ `& p&@ x& &@ & &@ & &˂ & & & & & 'W '( '7 @'S P'O X' h'w p'܊ '_ ' 'x ' 's 'mq' A 'l 'HA 'o 'HA ( (h (ܒ ((A 0( @( H( X(r `( p( x(` ( (k ( ($O (A ( ( ( (`e ( )e ) ) ) 0)d 8) H)d P) `)e h) x)0e )P )6^)% ) ) )w )܊ *_ * *x (* 8* @*v P* X* h*A p*` *B *l *0B *^ *x * *h *ܒ *҃ * * + + +g (+ 0+( @+1 H+ X+N `+$O p+hB x+ + + +d + +d + +e + +0e + , , ,`e , 0,e 8,S H,B ,S ,B , ,w ,܊ ,_ , ,x , ,h ,ܒ -B - - (- 8- @- P-`e X- h-e p- - - -d - -d - -e - -0e -$O -A . . .` (. 0.P @.6^H.l X. C .S .@C . .w .܊ ._ .P .6^.z . /S 0/`C 8/ H/w P/܊ `/_ h/ x/C / /C / /C / /h /5 /D / /PD / 0xD 0 0D (0 80D @0 P0D X0 h0(E p0P 06^0 0 0 0w 0܊ 0_ 0܄ 1Ą 1 1ф 1Dr 01 81U H1 P1p `1 h1Jx1 1 1x 1 1s 1X 1 1] 1 1' 1- 1 2h 2ܒ 2 (2g 82G @25 P2 X2oh2XE p2AK 2Y 2H2E 2 2\ 2k 2E 2qs 2q 2 2 3Xa 3“ 3 (3 03(r @3Ņ H3 X3Յ `3p3 x3ir 3E 3qr 30F 3 3 3Tr 3hF 3 3F 3c 4 4r 4F 4 04 846lH4G P4] `4@G h4%] x4G 4$O 46 4 4 4 4`e 4 4e 4 4 4 5d 5 5d (5 85e @5 P50e 5 5w 5܊ 5_ 5) 5G 5 5x 5 55 5X 6E 6s 6 (6ܒ 86DT @6 P6 X6 h6h p6 6G 6 6a 6|o 6H 6 6 6J 6 6 6HH 7 7H 7[ (7H 07oo @7H H7 X7 `7 p7`e x7 7e 7 7 7 7d 7 7d 7 7e 7 80e 8 08w 88܊ H8_ P8 `8x h8 x8s 8X 8 8s 8p 8 8 8n 8 8J 8† 8$O 96 9|o 9H (9oo 89H @9 P9h X9ܒ h9 p9 9 9 9̒ 9 9؆ 9 9 I 9 9ؾ 9 9HI : : : (: 0: @:d H: X:d `: p:e x: :0e : :R :V :B :$O :p ; ; ; 0; @; P; `; p; ; ; ; ; ; ;" <f <{ <0<@<`<x<<<<<==0=H=`=x=!====`==>`>@ >@@>y P>]`>fp>o>x>>>>>>>?o ? ?0?@?P?`?p?"?0?>?f ?{???@x~ @ @|~ 0@s @@ P@h`@8[p@#i@ @L@~ @ @Ȁ @ @ @~ A  A$ AS 0Au @A PA `AӀ pA* A߀ A_ AÀ A A A݁ A>A׀ B! Bڀ BS0BG@B PBM`BUB_ BYBaBiBqByBCRCR0CRHCR`CRxC CRCRCRCRCRDIm DR8D SPDShD3SDASDHSDPSDVSD\ D E\S(EeS@ErSXEzSpE7SE EXEkEkEkFkFl Fl0Fl@F+lPFl`F8lpFIlFZlF| F^lFglFvlFlFlFlGlGl Gl0G@GlPG m`G mpG*mG G=mGKmGcmGn8F @ 0ȘF Иؘ0R 0(_ 080Xh `h0q 0z ș0 0 (0H PX0x 0 0ؚ 0 08 @H0hǁ px0ҁ 0ț݁ Л؛0 0( 080X `h0 0 Ȝ0 0 (0H! PX0x* 02 0؝: 0B 0`f hu   " f u  Ȟ О" f u  ( 0" @d P܊ ` h  @ H PX ` hp x  p    x~ ( 0|~ 8s @hH~ P8[X#i` h1p x Ȁ _   * >! ~   $ S u  9\ G Y\ MU~ 8[@ PR`Rp ~ c~  RR RR$O ShEE E($O 0F8PF@FHFPFXS`$O h GphGxGh8hh)h6hAhPhah mh@c PL`tQpyhV hhh  h0h@hPh`hphii*i>iRiZZ[ fi0ti@i`ipiiiiij j+jFj`jyj j0j@jPj`jpkkk0kAkNk[kmkkk k@wmPm`mpmmmmmmn(n:nNnbn mn0~n@nPn`npnnnnoo(o;oLoco vo0o@oPo`opooo pp*p>pPpgpwpp p0p@pPp`ppq#q9qOqpqWq_qgqoq xq@~4H~MP~WX~g`~mh~xp~yx~~~~ ~8~K~M~^~p~~~~~~4~7~Ovz (;0M8@HPX#`=h@p[x]&/=M_@P`JJJ J(J0J8J@JHJ PJ XJ `J hJ pJxJJJJJJJJJJJJJJJJJK K!K"K# K$(K%0K&8K'@K(HK)PK*XK+`K,hK-pK.xK/K0K1K2K3K4K5K6K7K8K9K:K;K<K=K>K?L@LALBLC LD(LE0LF8LG@LHHLIPLJXLK`LLhLMpLNxLOLPLQLRLSLTLULVLWLXLYLZL[L\L]L^L_M`MaMbMc Md(Me0Mf8Mg@MhHMiPMjXMk`MlhMmpMnxMoMpMqMrMsMtMuMvMwMxMyMzM{M|M}M~MNNNN N(N0N8N@NHNPNXN`NhNpNxNNNNNNNNNNNNNNNNNOOOO O(O0O8O@OHOPOXO`OhOpOxOOOOOOOOOOOOOOOOOPPPP P(P0P8P@PHPPPXP`PhPpPxPPPPPPPPPPPPPPPPPQQQQ Q(Q0Q8Q@QHQPQXQ`QhQpQxQQQQQQQQQQQQQQQQQRRRR R(R0R8R@RHR PR XR `R hR pRxRRRRRRRRRRRRRRRRRS S!S"S# S$(S%0S&8S'@S(HS)PS*XS+`S,hS-pS.xS/S0S1S2S3S4S5S6S7S8S9S:S;S<S=S>S?T@TATBTC TD(TE0TF8TG@THHTIPTJXTK`TLhTMpTNxTOTPTQTRTSTTTUTVTWTXTYTZT[T\T]T^T_U`UaUbUc Ud(Ue0Uf8Ug@UhHUiPUjXUk`UlhUmpUnxUoUpUqUrUsUtUuUvUwUxUyUzU{U|U}U~UVVVV V(V0V8V@VHVPVXV`VhVpVxVVVVVVVVVVVVVVVVVWWWW W(W0W8W@WHWPWXW`WhWpWxWWWWWWWWWWWWWWWWWXXXX X(X0X8X@XHXPXXX`XhXpXxXXXXXXXXXXXXXXXXXYYYY Y(Y0Y8Y@YHYPYXY`YhYpYxYYYYYYYYYYYYYYYYYZZZZ Z(Z0Z8Z @Z HZ PZ XZ `ZhZpZxZZZZZZZZZZZZZZZZ Z!["[#[$[% [&(['0[(8[)@[*H[+P[,X[-`[.h[/p[0x[1[2[3[4[5[6[8[9[:[;[<[=[>[?[@[A[B\C\D\E\F \G(\H0\I8\J@\KH\LP\MX\N`\Ph\Qp\Rx\S\T\U\V\W\X\Y\Z\[\\\]\^\_\`\a\b\c]d]e]f]g ]h(]i0]j8]k@]lH]mP]nX]o`]ph]qp]rx]s]t]u]v]w]x]y]{]|]}]~]]]]]]^^^^ ^(^0^8^@^H^P^X^`^h^p^x^^^^^^^^^^^^^^^^^____ _(_0_8_@_H_P_X_`_h_p_x_________________```` `(`0`8`@`H`P`X```h`p`x`````````````````aaaa a(a0a8a@aHaPaXa`ahapaxaaaaaaaaaaaaaaaaabbb b  b (b 0b 8b@bHbPbXb`bhbpbxbbbbbbbbbbb b!b"b#b$b%b&c'c(c)c* c+(c,0c-8c.@c/Hc0Pc1Xc2`c3hc4pc5xc6c7c8c9c:c;c<c=c>c?c@cAcBcCcDcEcFdGdHdIdJ dK(dL0dM8dN@dOHdPPdQXdR`dShdTpdUxdVdWdXdYdZd[d\d]d^d_d`dadbdcdddedfegeheiej ek(el0em8en@eoHepPeqXer`eshetpeuxevewexeyeze{e|e}e~eeeeeeeeffff f(f0f8f@fHfPfXf`fhfpfxfffffffffffffffffgggg g(g0g8g@gHgPgXg`ghgpgxggggggggggggggggghhhh h(h0h8h@hHhPhXh`hhhphxhhhhhhhhhhhhhhhhhiiii i(i0i8i@iHiPiXi`ihipixiiiiiiiiiiiiiiiiij j j j  j (j0j8j@jHjPjXj`jhjpjxjjjjjjjjj j!j"j$j%j&j'j(j)k*k+k,k- k.(k/0k08k1@k2Hk3Pk4Xk5`k6hk7pk8xk9k:k;k<k>k?kAkBkCkDkEkFkGkHkIkJkKlLlMlNlO lP(lQ0lR8lS@lTHlUPlVXlW`lXhlYplZxl\l^l_l`lalblcldlelflglhliljlklllmmnmompmq mr(ms0mt8mu@mvHmwPmxXmy`mzhm{pm|xm}m~mmmmmmmmmmmmmmmnnnn n(n0n8n@nHnPnXn`nhnpnxnnnnnnnnnnnnnnnnnoooo o(o0o8o@oHoPoXo`ohopoxooooooooooooooooopppp p(p0p8p@pHpPpXp`phpppxpppppppppppppppppqqqq q(q0q8q@qHqPqXq`qhqpqxqqqqqqqqqqqq q q q q qrrrr r(r0r8r@rHrPrXr`rhrprxrr r!r"r#r$r%r&r'r(r)r*r+r,r-r.r/s0s1s2s3 s4(s50s68s7@s8Hs9Ps:Xs;`s<hs=ps>xs?s@sAsBsCsDsEsFsGsHsIsJsKsLsMsNsOtPtQtRtS tT(tU0tV8tW@tXHtYPtZXt[`t\ht]pt^xt_t`tatbtctdtetftgthtitjtktltmtntoupuqurus ut(uu0uv8uw@uxHuyPuzXu{`u|hu}pu~xuuuuuuuuuuuuuuuuuvvvv v(v0v8v@vHvPvXv`vhvpvxvvvvvvvvvvvvvvvvvwwww w(w0w8w@wHwPwXw`whwpwxwwwwwwwwwwwwwwwwwxxxx x(x0x8x@xHxPxXx`xhxpxxxxxxxxxxxxxxxxxxxyyyy y(y0y8y@yHyPyXy`yhypyxyyyyyyyy y y y y yyyyyzzzz z(z0z8z@zHzPzXz`zhz pz!xz"z#z$z%z'z(z)z*z+z,z-z.z/z0z1z2z3{4{5{6{7 {8({90{:8{;@{<H{=P{>X{?`{@h{Ap{Bx{C{D{E{F{G{H{I{J{K{L{N{O{P{Q{R{S{T|U|V|W|X |Y(|Z0|[8|\@|]H|^P|`X|a`|bh|cp|dx|e|f|g|h|i|j|k|l|m|n|o|p|q|r|s|t|u}v}w}x}y }z(}{0}|8}}@}~H}P}X}`}h}p}x}}}}}}}}}}}}}}}}}~~~~ ~(~0~8~HH HtH5I %I hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhѿhh鱿h顿h鑿h避hqhah Qh Ah 1h !h hhhhѾhh鱾h顾h鑾h遾hqhahQhAh1h!hhhh h!ѽh"h#鱽h$顽h%鑽h&遽h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1Ѽh2h3鱼h4顼h5鑼h6遼h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAѻhBhC鱻hD须hE鑻hF遻hGqhHahIQhJAhK1hL!hMhNhOhPhQѺhRhS鱺hT顺hU鑺hV遺hWqhXahYQhZAh[1h\!h]h^h_h`haѹhbhc鱹hd项he鑹hf遹hgqhhahiQhjAhk1hl!hmhnhohphqѸhrhs鱸ht顸hu鑸hv選hwqhxahyQhzAh{1h|!h}h~hhhѷhh鱷h顷h鑷h遷hqhahQhAh1h!hhhhhѶhh鱶h顶h鑶h遶hqhahQhAh1h!hhhhhѵhh鱵h页h鑵h遵hqhahQhAh1h!hhhhhѴhh鱴h顴h鑴h遴hqhahQhAh1h!hhhhhѳhh鱳h顳h鑳h遳hqhahQhAh1h!hhhhhѲhh鱲h顲h鑲h遲hqhahQhAh1h!hhhhhѱhh鱱h顱h鑱h遱hqhahQhAh1h!hhhhhѰhh鱰h顰h鑰h遰hqhahQhAh1h!hhhhhѯhh鱯h顯h鑯h遯hqhah Qh Ah 1h !h hhhhѮhh鱮h顮h鑮h遮hqhahQhAh1h!hhhh h!ѭh"h#鱭h$顭h%鑭h&遭h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1Ѭh2h3鱬h4顬h5鑬h6遬h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAѫhBhC鱫hD顫hE鑫hF遫hGqhHahIQhJAhK1hL!hMhNhOhPhQѪhRhS鱪hT顪hU鑪hV遪hWqhXahYQhZAh[1h\!h]h^h_h`haѩhbhc鱩hd顩he鑩hf適hgqhhahiQhjAhk1hl!hmhnhohphqѨhrhs鱨ht顨hu鑨hv遨hwqhxahyQhzAh{1h|!h}h~hhhѧhh鱧h顧h鑧h遧hqhahQhAh1h!hhhhhѦhh鱦h顦h鑦h遦hqhahQhAh1h!hhhhhѥhh鱥h顥h鑥h遥hqhahQhAh1h!hhhhhѤhh鱤h顤h鑤h遤hqhahQhAh1h!hhhhhѣhh鱣h顣h鑣h遣hqhahQhAh1h!hhhhhѢhh鱢h顢h鑢h遢hqhahQhAh1h!hhhhhѡhh鱡h顡h鑡h遡hqhahQhAh1h!hhhhhѠhh鱠h顠h鑠h遠hqhahQhAh1h!hhhhhџhh鱟h顟h鑟h遟hqhah Qh Ah 1h !h hhhhўhh鱞h類h鑞h遞hqhahQhAh1h!hhhh h!ѝh"h#鱝h$顝h%鑝h&遝h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1ќh2h3鱜h4顜h5鑜h6遜h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAћhBhC鱛hD顛hE鑛hF遛hGqhHahIQhJAhK1hL!hMhNhOhPhQњhRhS鱚hT顚hU鑚hV遚hWqhXahYQhZAh[1h\!h]h^h_h`haљhbhc鱙hd顙he鑙hf遙hgqhhahiQhjAhk1hl!hmhnhohphqјhrhs鱘ht願hu鑘hv遘hwqhxahyQhzAh{1h|!h}h~hhhїhh鱗h顗h鑗h遗%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݿ D%տ D%Ϳ D%ſ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݾ D%վ D%; D%ž D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݽ D%ս D%ͽ D%Ž D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݼ D%ռ D%ͼ D%ż D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݻ D%ջ D%ͻ D%Ż D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݺ D%պ D%ͺ D%ź D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݹ D%չ D%͹ D%Ź D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݸ D%ո D%͸ D%Ÿ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݷ D%շ D%ͷ D%ŷ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݶ D%ն D%Ͷ D%Ŷ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݵ D%յ D%͵ D%ŵ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݴ D%մ D%ʹ D%Ŵ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݳ D%ճ D%ͳ D%ų D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݲ D%ղ D%Ͳ D%Ų D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݱ D%ձ D%ͱ D%ű D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݰ D%հ D%Ͱ D%Ű D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݯ D%կ D%ͯ D%ů D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݮ D%ծ D%ͮ D%Ů D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݭ D%խ D%ͭ D%ŭ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- DE1{AWAVAUL-ATAUSHHXH=- dH%(HD$H1@H; OH=, H/  H/ 1@vu$H(H H=/ 11H5aAH=/ H={/ L5C8LOH1:L8H=1 Ht1IH=1 [H5H{1 H=: H=/ H=d1 H5eH=. HF1 YL豙HyH=*0 HtxH0 H=. 葧DiTH0 H=H 0 ՕH/ HHtH5`L-1LAHHtH5bHHH=HHtH5 J1}iHHt_H;-IH- H\Ht$HLt$3HL3Eu(H{ HfAHIELDHfAH=. H5_[H=. H5E`H=. H5`襜H=n. H5`:H=, H51A:H=, >H='/ [H5薴H / H=O, Et$eAL{H$.LcH5LH5#LD$ T$ ÅH5LH5LyH5ϾLbtH5LGÅAH zH$'H=s+ H6zH)H1oEHf HdAIH$'H=+ H δHyH)H1H5b\H:H5`HH5d\H H5]\HuH5^HH>H=* 1H5ZU8Hq* HH=\H=T* wLH=O蚖ALcMEH5LqH5ѼLUH5L>u AH$'H=w) H ,H)H1H+xlE&H$'H=5) H HwH)H1*H=91H$'H=( LH)HzH U1 1I^HHPTE11H= f.H=% H% H9tH Ht H=% H5% H)HH?HHHtH HtfD=m% u+UH= Ht H=r dE% ]w1fUHSHHHSHt.Ht)w HryK`1~SdtIH[]f軗HDH=L&11Ҿg:谧H[]@HHHCXH[]@H1[]AVAUMATIUHS6HtyHEHHtiMtdMt_DpPALaA9HSXHCdCd;C`|eHUHCX[IE]A\A]A^賖H|H=D%۫11Ҿg:訦1[]A\A]A^DHcCh[]A\IEA]A^f[H$H=$胫11Ҿ:P[1]A\A]A^DHH=$C11Ҿi:1cfS֩Ht)@dHxXHޗHCX[裕H H=4$˪11Ҿg:蘥1[@AWAVAUIATIUHSHHdH%(HD$81@HHMMDpPHAtHgA9tLjH LE1H=z#1Ҿ1:ޤHD$8dH+%(HHD[]A\A]A^A_苔HFE1H=#谩1Ҿg1:}LAƃt0H H5J LE1HIEAa1LHH1IIEHL==k=OHD$0蚰HHH;&E111HHtx˷IHtk1ɺLHGLIH|$0LH|$HH|$YLHLH@H|$0fDI}E1!=kHt$HHD$tLd$HkHD$ HD$(HD$0L;Hz1LRHL$0HT$(HHt$ cH|$(HR1Ht 8+H4H= S1Ҿ1: E12Ht$0HHD$0 H|$0H{0t)ѾH|$0HľHHyH{0Hs8HS@оHDI}H֯yH!H@H{(HEHNH=m1Ҿ1::%111JHz1kHkH|$0tHcH|$0HFyH{HL菠H臠L?Ht$0H2HL`HHLCxfHoH=莥1Ҿ1:[FfDAUATIUHSHHHMHDkPAt]HEA9tPH{HtG11E1ˉHHtfLHHؒAH[D]A\A]@苏HdE1H=谤1Ҿ1:}HD[]A\A]CHE1H=h11Ҿg:5HD[]A\A]+HϤH=1Ҿ1:ifDATL% A$uE1=t bLA\@<-u=] ~HHDlH= L t PA H HuPH5=415 H fHHkH=F L dt PA H H*PH5315: mH LA\AUIATIH5UHSHH= dH%(H$1$M[HLH= H5HHHGHD1MLDH=} H5H1H贛H=U H5|11L%p%@HH=$ HH_9}tH= L1F@H= H5j1+H$dH+%(urH[]A\A]f.H= H51fH= H5y1 fDH=i H501AUMATIUHSHHHt$HtHLLH[]A\A]HԡlH=t H1Ҿg[:]1A\A]Λff.AVIAUIATUHHHI\HMtLL9u-HtHLH]A\A]A^@H1]A\A]A^f.AWAVAUIATMUHSHHL$HL$LD$ L$L|$dH%(HD$81ўHHMHMMHD$,CPm9eHD$SdI$IHC`~9CdHT|$,u]HD$HtSH;tMHHkHHD$蟅H|$HҺH;HHtH?H{HtrI$HHtjHt$ H|$xSH{ Ht lIHt4H{(HtVHT$HHtH{HHtD˜IHu:I<$跙I$I>7H\$IH;#HE1HD$8dH+%(HHL[]A\A]A^A_H4*H=|1Ҿg1:E1H{HfHHLHHHRI<$fHدHCXH/HD$8dH+%( HH11[]A\A]A^A_;H\/H=;1Ҿ1:E1HE1HH AH$A9wDHHHD$#H;LD$=uHt$0LbNH|$0Е+H|$01,HH+HHH5H_]H=>1Ҿ1: H*qH=r 1Ҿ1:֖E1fD1'HD$藆HkH=(进1Ҿ1:茖LD$I]HYH=腛1Ҿ1:R(HqR fAVAUIATIUHSHHDpPHAtGH/A9t:LL tH;HtLLH{H[]A\A]A^fD苅HH=賚1Ҿ1:耕[1]A\A]A^DKH|H=s1Ҿg1:@fDHDH=;HZ1:끐ATSHL%: MA$iH56L 4c;H5LlrsH5LAEta=( 'HH bL y AFPH HsPH5K*AT=@A|$rQAD$CH=W  HtH- VvAąH= HtH vAą8H= HtHY vAątLAHD[A\hfDA|$rA|$EfD= KE1HD[A\D= ~HH`L ]x AJPH H0PH58)PH= 1AH = ~HHx`H= L x PAVH THٗPH5)P1H =9 8HH`H=q L w PA^H H}PH5)P1H @fDA|$rA|$kfDHH_H= L 'w PAcH uHPH5(P1H fAVIAUIATIHtLA\A]A^DH= LL1H5(LA\A]A^AWAVAUL-} ATLUSHdH%(H$1D$THD$xHD$pHD$hrIHHHD$(E1E1H|D$<D$8D$D$4D$HHD$HD$ HD$f蛆 wHcH>H=Y HT$TZsufDH=I LH511E1E1E1E1L"LLA H= `HL%xH|$p:L诗H|$h;L蝗LH譧H$dH+%(4HĘD[]A\A]A^A_ÐD$4蓅1D$@轊MDL$@t51ɺrLIHH3L+DL$@T$TH|$1ɾrDL$@ܫIHMDL$@/1LwDL$詫DL$HI1E1E1D$HH= 11D$8L5q @L=a @HQ HD$L1E1E1耊E1E1L2L*LE1f.H= 脞HD$(HfH H= H5n 1L% #H= H5h HP0H= L1HH識Hu[D$THi HD$ HQ HD$H59 H聛@H= 11蠽D$D$sH= 11pD$IED$RIE@M}Ll$ ZEHsH|$8FHHD$HH|H=y H551H\$ D$Ll$ Ld$PfL+HLH I9uHD$XdH+%($D$Hh[]A\A]A^A_DHL$HHT$8H51H= 9WHH=YiLHD$ HLI‹LLT$xLcLLD$LD$LT$HICLL$(IcLIrLT$譒LT$H]IH=p IcHD$0A`H|$ HD$@8HL(L޿8IHIA0foD$ LfoL$0foT$@LL$IAAIAQ 蘙LL$?HD$ HD$(HD$0HD$8HD$@HD$HD$AHL$DLLLl$ D$fH|$1L5IH肛MqHT$H= H51_vD11诽IHt`H5LcL[IHtcIvLHĺLqMv11UHD$HH5 H= 1D$Ll$ H L1H5 H=&lIv1LCLkqfH|$VqLHT$H= H5nYmLzHL$HD$D|lD$Ll$ H\$ H-kLH51D$Ll$ HHT$8H51D$Ll$ #H=u H5q1LL$IGH=W H5nHP 1H|$lHD$Ll$ HT$8H51^D$Ll$ 跞H5[HD$H 18H5q H=jLL$H X1LH5H H=qjHD$1LHp艸L*c 1LLLT$Pr1LLCrH|$LT$LH|$xoHD$H %1LH5 H=LT$JjLL$LT$ff.ATIUHSH0HL$HT$ dH%(HD$(1Ht$ H|$D$ HD$ HD$HD$HtpHt$H輩txDd$ 1AHT$HtE11ɾH[HT$ HHE11ɾ3HE1~E1|$ AA 1E1亰 H51ȄH|$ >H|$DH̚H|$RHD$(dH+%(H0D[]A\frHHtIcH舦AątQE11HھH|HE1^fE1|$ HAA=H-AWAVAUATUSHH $HL-(a f1LL5 E11H{dH%(H$1f$=HDŽ$DŽ$DŽ$HDŽ$5Ƅ$?DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$)$@)$P)$`)$p)$\D$\H$HD$pHD$DŽ$(HDŽ$HDŽ$HDŽ$HDŽ$DŽ$ DŽ$DŽ$DŽ$D$HDŽ$DŽ$$DŽ$D$(DŽ$HD$HDŽ$HDŽ$HD$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$`HDŽ$HDŽ$HD$PHD$hHD$ HD$xHDŽ$HD$8HD$0HD$@Do5|6wHcH>=DY=@ #wZuHD$A11HD$E1E1E1HD$ aH -E$(H$AH HD$/H H$@H$H=q w[H$11E1H=R 1E1E1H5E1HD$HD$HD$ H= tnD$(H|$p1p1pH|$xHD$HtHrH|$HyEBH$LMt1I~L%{uI~LWLLGH|$0]H|$8SH|$ }HwH9tL董H= 腣H|$@H$dH+%(rD$(HĨ[]A\A]A^A_fDD$\kD$HHca Hb H1H8H$0$,tHH8u$,A>H= 2H5R11LZIH@L95O tH}ADžRHuHC1L製IH肕LH5;e~IH0HLLaADžL5Xd LL"U VADž}tHHLHH H袽ADžH$.HDŽ$8DŽ$tHvHL跼IHE 薔L~$H|$fL5GHLLvIHH$HIHL6 HD$1E11HD$E1HD$ @H HD$hDŽ$HY HD$HA H$@H) HD$`H DŽ$HD$P@DŽ$xHDŽ$_H H$D@H- 4@L5 $@D$\H=y 1Ҿ-MHD$@L1E11oE1E1E1D$(HD$HD$HD$ $DŽ$H D$HH$@H DŽ$HD$Pd@H D$HH$D@H= 1-H$ H= 1 H$H=i 1H$HI H$@H1 H$@ DŽ$DŽ$ qD$(cDŽ$$PH|$0:H5 H|$0+HD$A11HD$E1E1E1HD$ [H|$8H5U H|$8HD$A11HD$E1E1E1HD$ L% @H= H$Sof.H D$HHD$PGDŽ$ 0L= H5XL芓HD$p H5@Lj HD$p@HI H$@H1 H$@H HD$ H HD$xH H$l@H= 1UHH$FfDH H$,@H$H HD$H|$H5(:wDLH541蟾f.KHD$A11HD$E1E1E1HD$ HD$11E1HD$E1HD$ fDHD$11E1HD$E1HD$ L=L5] LLLHH5H=w LL1H51E1E1諽E1HD$HD$HD$ S7HD$11E1HD$E1E1HD$ HD$11E1HD$E1HD$ 蒙XHD$8HNHD$11E1HD$E1E1E1HD$ jHD$0HHD$11E1HD$E1E1E1HD$ 'lHVHL蠴IHH58LPHDŽ$8H= H11H51E1E1%HD$HD$HD$ H|$ jE1H|$H\$$1L LD$@H|$ HpHHD$ &gHH{nH|$ vH$$ $@$@;3H$$$1HDŽ$HjHLLLIH+A$'A4'$h$H0SHDFuH= 11AT$AE1H$H5Y4HD$H|$bH5HDŽ$L`HHDŽ$HDŽ$LHDŽ$HDŽ$HDŽ$HHH$@F0Ht$H{HwwD++@tuRHHHC+@uH$I~HHD$(OjHHH$H= HD$HD$HD$ H= L1E1H5(E1HD$]H= AT$11H5nH$E1ưHD$HH LH5 1H=yM|$\H$Ls$I|$\J蓅IH11H1DŽ$HH$H$PL$ fIFHx^9IFHxIIH8Vu HHoIuHXW LH螇H辚H$11E1H=& H5jHD$HD$LH$PL$H$c$%|$\H$Ht41H蓌H IH4 |$\ H|$`D$H $$t(H$ $@ $D$(H$@H|$ PHH$kb$ L$M H5vL;t H$H5#L$uH$$H$|$H$M|$\R!H|$x"!HHL9H HDŽ$D$H$L%( ML$11E11AL8H5 LoHT$`1LH= Ccg!H$9!H|$H$HD$H$H= H51$@,H$HH1oHt$xLD$D$1uHci AHg HL8M1HH8uHHE11E1膁H= H5H1Ήb@1"AE11E10f.H=9 L1E1H5A1E1jD$L#H;H$8dH+%( HHD[]A\A]A^A_fD$D${AmDA]DAMDA=DHY HD$ 'D$ADH-! @D$D$LE1E11@5D$E1LP@1)4E1fHT$(H5| H=} H4IHt1L{HNMHuH= E1A.U1L|LMHtDT$EDL$EHD$ HtHL[-MtLLOLRIHjDD$HEqIŋt$1ۅH- L5qH= H1L59DLNaHHtUHH!tH=b HD$L1諆HT$H,)D%= HH=! H1HAЉH5[T$uOHt$0HHH= H2bL'59}wL`HHtߋL$t`H'H= H5HHHHD1օH5L544H5)L<L:H=E 1E1LH5艅mIMH= DH5X1_H= H5(GiH= H5/QUDATMAȉHHH= A\Bff.ATMAȉHHH= A\Bff.ATIUH!K11HHBu1H]A\@11H"t11HYtҾHC MtLHpt1LHӁfATUSHtWL&HMt4HL#HLHaAE[]A\D=13 _1[]A\=3 ~HHL  A-PH H9PH5(PH=0 1yH 1뤐HHL N A1PH Hi9PH5PfD=2 \HHtL  A8PH WH$9PH5$ATnDAUATUSHH.H IHH"HHH7 H58 IHt=2 zHL[]A\A]@=1 HE1[L]A\A]fDHHH= L G PARH HR8PH51U2H @HHqH= L EPAT1H KUH8H5AUH LH[]A\A]=)1 YH = = HSfH= hHÈ H#AVLH=s PL A9H PH5NP1XH 1SH|$@ @HALH= HL +PH H5PP1FXH D= HALH= H[L PHh H5yPP1WH E,fHALH=T HL kPH H5/PP1WH H D x EH= QH=e H=o H=) =, fD¾ HQF &D=v HG H=) HALH=_ HL PH H5zPP1VH oH= H= H=H H= H8= MHH~L APLH2 H5SPPPHALH= H=L PHJ H5PP1UHӅ H HZDf.HOfH~Orf^ DH= JHH{L APLH H5pPPMHA%LH= H9L PH H5gPP1TH PDHA!LH=L HL cPH H5dzPP1~TH LE1 H|$0= kHHLPL -H5~APARH mH= t =p H=ۄ L- HtHH LH! IHHHL5K Mt L HLD= L  LHm DLL$LL$LL$IL E HLHqs H= YH=u K= ZPHL #LPAoHrH5PP`H= H=n H=X @ w=1 jHARLH=` PL }AHPH5P1NH )f.H=  O= BHA/LH=~ HL PHH5fPP1%NH H= HtH=P  =[  H=M t=@ t =; NH=  t =$ ~ D~ Et = H=~ t = p H=~ t =  H=~ t =  =  = | uXH=| tN= ~EHALH=} HbL PHOH5PHP1LH =9 W=} t =& n } = H={ H={ = PHLH=} PL /AHPHMH5P1>LH H=}} L-h} MHALH=| HKL PHH5yPP1KH 8H=/} H=z t = H H=| t = x | = = H=V| = PHLH={ PL AFHtPHH5P1 KH L-u| Mt=M E1=A GH=| FHD$8HLt$@1AE1L1L]>H5y L H{ HtH=y HL$8LdH{ HtH=y HL$8L@Ht$8HqL9%HADž H=>{ 1=a HHL AULPAH*H5PP@H1{ H H 1{ H(= ~HHH=1z L OPAH5T1RHQLaI H E= } x p |=} /HdL WLRAH5_RH?P5H=9z EH=z = ifHBADž-= PHL lLPAjHH5PPH=y D H=y H=Ay wH=y H=y H=wy =b HIAPH=x LPL A8H$PH5P1G H = H=v   HALH=x HL 6PHH5PHRP1JGH D v E= EHvAPH=w LPL AHQPHH5BP1FH H.RABLPH=pw L H PH2H5P1FH = ,=  PHLH=w PL 8ADHPHֵH5P1GFH H<@H=Gv 9=r $HYL AVLPAH;H5<PP)H*RALPH=lv L HPHH5P1EH H=t = PHLH=v PL 3AHPHQH5jP1BEH L-v MtLHӨ1IHHT$@HLLfH|$@v¾"H>tD H>= HL SLPA[HH5P5Ku H=~t H=u H=u H=u =s HADžfHAGLH=t HIL PHH5PP1CH H=t   H= u * = ~PH=t HHQH=t LL HPAH5ZP1RH:CH H=>s @= 3PHgLH=s PL AHDPH5lP9fDH=t LH z11jZIHHH#5= s H5 H|$8E17LH|$0HALH=r HL PHH5PH/P1'BH )HALH=r HWL PHDH5PHP1AH FHALH=hr H L PHH5PHP1AH HALH=r HÿL 5PHH5aPHQP1IAH HALH=q HyL PHfH5PHP1@H 8H=Vr H5 H H2ADžf= HL AWLPAHH5{PPHuH=q Hq  H0= #PHL LPAHH5ͬPPH=p 1@H5&q H H=] HDL WLPAHH5pPPH*q HH=)q H $q H= qHp Hp HuR E1M111uIHt^%HLL]HHIH5}LHuH9¾@LRHE1111MI$Mj= HUALPHvH=5o L nAUHH5P1f>H ]HWH=n LPL A>HPHH5P1>H qHcVA@LPH=n L H?PHgH5P1=H AHARLH=dn PL AHPHH50P1=H HԻAULH=n PL 9AHPHWH5P1H=H jHB7 :LHɃ5H=yn =T H;L AULPAHH5fPPH APH=Wm LPL AHPH5P1L8HHADž L-l MLH=l IB1IH2Hu= ~HH=.l L LASLHH5S5l [;H JHVALPH=k L H{PH#H5̥P1;H K=d HKA2AQLPL H-PH5UP=( HL VLPAHH5SPPPHLH=*k PL GAuHPH5]P1]:H yHAVLH=j PL AH|PH5dP1:H H=k H5k =W cH>AVLH=j PL AHPH5Q15j 9H  = HL {ASLPA HH5qP5zj H=j i= bHL ,AWLPAHyH5PPgHhVALPH=i L HDPH5P18H MFH $IDH=LE1H|$0HASLH=9e PL VAHPH5P1l4H = !HARLH=d PL AH~PH5P14H H=e CH=oe 5=R H9AAQLPL HPH5PH HDHt= PHL yLPA HH5PP= HWH=c LPL AHPH5P1&3H _HjAPH=c LPL AHEPH5}15d 2H =d lyDAWAVAUATE1UHSHHHT$DIH<AHt = 7A~= t = H"IHHٺlH E1E~gf.DHu W IƁtdtt!tHS H=b H511= AL[H3HD[]A\A]A^A_ÐHLu1 ufDLL(u gfDAE93뎐HH=a 1L *SA` H j`Ht$H5DAT1H AfHH9H=a L PAo 1H `SHH5t$ 0H fDHHH=6a L TPAc H _HbPH5P1b0H fE1= AHHhHhH=` HEHL Ag t$H I_HPH51S/H *ff.fATUSHtHHXuAD[]A\fD8tE1= ~HHӭH=(` L aPA 1H ^UH1H5SL/H fDAVAUATUHhdH%(HD$X1Ht|IHIHt~I*LHI6Aąt?LHL!AHD$XdH+%(ucHhD]A\A]A^f.LHfDAIHѾPLHfLHAAWL=]AVAUAATIUSHhdH%(HD$X1$Ņ6yfIPL~t=U 9|5sLMHIHMu=# E19}HD$XdH+%(OHhD[]A\A]A^A_DE1= ~HHūL ZA PLH!H5PH=] 1SB-LKf.HHyL A PLH1AVH=] H5S,H @HH1L A PLHH5PH=f] 1S,H D= HHܪL A PLH8H5YPPH=] 1Y,H ff.AWH F HdAVAUATUSHdH%(H$u.HQHHt6-uBSu BtD:-uЀzMuʀztD1۹E1L= AH du5IWIHAO-uBSuBt:-uzMu zt0AƒA EՃv~EuyAw -t}Nƒ5w*HH@Hu^H H~E1=$ H$dH+%(HĨD[]A\A]A^A_fAw A-uH5 H=Y 萴Ht 8A@H5 H=rY ]HHtEAG l/E-tNuCLHHH9kDH=ޤ AHD YfDntHt 1;HDDH= HHA# Ht$H HHHHT$:AW pNu HIELl$@I1QHaLA -Ll$(HW HD$ MNDDH=֣ AHL QfDHHH=nY L PA H W1RHOVH5w(H fHIE[IH|$@1QH`H|$H|$A -H W H|$(HD$ t)fH=IW IH5w *HD$0Ht$ HĦ ?v:H-W H= E1fk贴DAIH=3X H51u'IH1H=ܞAٯIH1H=A躯wHH~H=W L PA 1H XV5n HH5 A7&H -o H5'VH=:f.ATL% ULH-SHTHdU @KI|JwHcH>=D!=~#gwHcTH>@/wH5V uHT H=V H5'V1%[1]A\1t[]A\9!s7H$T ;e  LX[]A\fD#7H4W  7HV 6HT 6HV o6HT W6HV ?6H, '{6H ~U fK6HLU 36H$U 6HU -U 5HU 5HLS g>S Q5H S ?5HU '{5HS c5HR K5HT 35HT 5HT 5HlR 4H\R T ifT Q4HS ?4H4T '[  = qHHՠH=*S L cPA H QHPH5vP1N"H *D*S 3HDS 3H4S w.S a3HS O3H S 73HP s3HR [3HdR C3HR +3HtP 3HR 2HO 2HO w2HO _2HLP G2HL=2DD$ |$ HHH5L1H9#HYHIH=te=uLH5tL1f= CHD$(dH+%(zH8[]A\A]A^A_DLHT$Ht$LHILL1;Ht$ L^|$t7I~t0LH5M1jE11LHLGfH5<L1f.HH5L11LL膸H== L5KHHXHL= HHH=E L 8PA H xDHPH5H5P1H uD=Y fHH <H=E L QA H DH}t$0H5P1H fHHH=>E L wPA H CH*PHH5P1[H fHHH=D L 'PA H uCHPH2H5[P1 H rmff.fAWIAVIAUMATUSHH5FD H=GD dH%(HD$1bH$Ht]t|H=5D LH51tH<$E18HD$dH+%(HL[]A\A]A^A_fH11L葿L$$HuH=C LH5HLHLL0fDH=C I1H5c6fDATAHUHHD +t uAuH*HD]A\ff.@AWAVE1AUL-4ATL%USHH|$H|$BA9}yDH|$D1HA@HH=B LIH=B LH=B LH9|H|$AA9|H[]A\A]A^A_DAVAUIATUS IHtx1Z@LE1ɹ1I11IHtH#HHt@LH@t1HL1tUL29|[L]A\A]A^fE11H5, LE1iHL)[L]A\A]A^DE1AUIHATUHS1Hƿ!+H&LHI~$H虿9|H[]A\A]DH=)A LH51hH=A lH1[]A\A]ff.@ATUHH5TSHtHI1HLHHH9|L[]A\f.[1]A\fAWAVAUIATUSHdH%(H$1HDŽ$HDŽ$HDŽ$HDŽ$ HDŽ$IJHDŽ$H$DŽ$xDŽ$tDŽ$pDŽ$lMt HH$E11E1HD$(AHDŽ$HD$xHD$PHD$ HD$XHD$pHD$HD$HHD$hHDŽ$HDŽ$HD$HDŽ$HD$0HD$HD$`HD$8HD$@HDŽ$HDŽ$H=> +LH-蜿H$菿H$һH|$hH|$H~H|$xHLH$H7HL'H$H|$0H$#H$Ht#H{HH[HHuH|$PH-H|$3H|$p)H|$XH|$ H|${H$NH$AH$tL謸H|$袸H$H|$`kH|$@aH$TH|$8*H<$/H H|$(0HH$jH$dH+%(%HD[]A\A]A^A_fDH< L1H3 E1E1H$HHH-W H > KD$@HD$pH:H$HDŽ$HD$xHDŽ$HDŽ$HDŽ$DŽ$XDŽ$DŽ$DDŽ$DŽ$@DŽ$(DŽ$HD$@HDŽ$HDŽ$HDŽ$HD$XHD$HD$ HD$(HD$HDŽ$8HDŽ$DŽ$4DŽ$0DŽ$,HD$8HD$PH$HDŽ$ HDŽ$HDŽ$HD$`HD$0HDŽ$HD$HHD$hHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$@ӰP|QwHcDH>fD== =D=@ #wڛufDHD$(E1AH$HD$PHD$ HD$XHD$pHD$HD$HD$0E1HD$HD$`HD$8HD$@=FH=9 H$H =% =Hk9 HD$ H7 HHD$8DŽ$(DŽ$P}AhH|$PHtH$  H|$XH<H$F'HT$XH5r8 H=薐qH$tH=8 &訛HT$pH=8 H5711DŽ$DŽ$H= E1E1E1茴H$HD$(HD$PHD$ HD$XHD$pHD$HD$HD$0HD$HD$`HD$8HD$@H7 H$8L57 H$4 H57 H$3$HD$0L )H|$HAH|$H蕵AEHD$@Ht D98 H57IH8L$PL$PHI@HE8I@HHD$@LD$@L@H56 T@H$xH=|6 1Ҿ0H$H\6 HD$8H=K6 H$lIy@H|$0tPM0H|$hH|$hLNH|$HHt$0H|$H+E1H5 HD$0H5 HD$PH5 H$H$H55 H$.fDHH'L$H$d$L$zH$p|DŽ$]DŽ$MDŽ$D=H4 HD$`,DŽ$4DŽ$, DŽ$0H4 H$ H4 H$H4 H$Hq4 H$L$L$L$ L$L$tL$@gL$Zd$PL$CL$9L$ /L$%L$L$L$DŽ$ DŽ$ DŽ$ DŽ$ DŽ$Hb3 H$DŽ$ DŽ$}DŽ$mDŽ$]H3 DŽ$HD$ADŽ$X1DŽ$!DŽ$DŽ$L$DŽ$H2 H$H2 HD$(H$H=g2 11JH$HHB2 H=K2 H5f.H2 H$TH$H=1 >H$H$HH$H$ H|$xH=1 H$HD$xHH$H$H=y1 $$H=N1 EH|$Mt^H|$hH|$hLpHD$0HLEH|$HLl$0Ht$0H|$H<HD$0L-0 H0 H$H0 H$H|$8HtH$ Hc0 H0 $H,1H$"$%$P1H$0 HD$hH D$H` D$tD$ $ $ $9 $H|$(H|$(1HD$(HH=/ H521GH$џ)$@@H0 HD$X詋y@E1H|$HHD$hHHD$(E1H$HD$PHD$ HD$XHD$pHD$HD$E1AHD$0HD$HD$`HD$8HD$@HD$HHnc@HD$hH GHD$HHC'HT$PH5- H= L¶1ɺ1~IHJ HL'HD$(E1L|$AH$HD$PHD$ HD$XHD$pH$HdDH$HDDHxH$ $%$P D$tD$ H|$0IM H|$h H|$hLH|$H HD$0H|$HHLELTH|$(tH|$(1HD$(HHD$0E1틄$%$\H|$`tH=N, H51$D$%D$PhD$PDŽ$xE?D$D$P$-H$Ht 11H$L_l $H|$D$8HL;1ɺ1HD$pH H|$  H|$ Lb11çHD$ HH|$0 HD$XL$HL$(1L $lH|$0iHD$HH$$MD$%@@H$H$HD$@H$HtH|$H $pHH5۲HEHHD$`HHt$`$p11L޾HD$H|$PwH$8D$t1HD$8H $= HD$P= $ $' $ $$  $0$PY$/L$HD$0D$H$1L$Ld$X D$L|$$H|$hA9CH|$hH|$HILM11LH3IHL$HL$(1Hߋ$lL ]IHH$H?H H[H-9+uD$LLLH$aIH&HHD$XHsH|LD$rH|$0tHt$0L ULE1$LE1艭LD$@LLgLDxTH}tH=' H5)1D$$u DŽ$tD$\E*D$$P1DH|$`ED$P4HT$8H5& H="~D$@d$mH\$@H$H$11H$LR}_sD$8H|$ t(H|$ L11HD$ H$$$|$8$==H$HD$XHD$pHD$H5H=% 1E1A0H$HD$PHD$D$PH$H|$xH$ ˆT$84H}HH\$@$HL襳NH}HHiL1ɺ1跡HHuHD$H\$@E1H$HD$PHD$ HD$XHD$pHD$HD$0E1AHD$HD$`HD$8HD$@MH|$hH=$ H51D$(H=q$ H5bHD$0H D$yH$H D$xHD$0]H=-$ H51oHD$xqH= $ H5kNYH5JDL$PrLED$x1HD$@HH D$\ET$$xH$LIH Hl$`Ht2H$eH5ثHFHD$8H$H H<$LH<$HH.HH$|H=" H5>IH=" H5&1H=" H5[HDŽ$ H}H$H D$xLנH=x" H5!1HD$x@HD$hH_/HH=6" H5׼1xH " H=" H5YHH=! H5S1L觯HD$0HM 1HDl$HT$H$Ht$XHEHD$0HH LID$HD$0$D$Dl$Ht$@1L e L$HDH$@$iIH;A@HD$01D$D$L藔9;LHHI MvMtA9.uD$HL$ HT$H|$0*IHHIHtMtIvH=twH$E1ɹ LA蟆uDLt2H$tLE111H$HtLt$0E1AHD$HD$0VE1Lt$0E1HD$0AHD$-HD$xLt$0D$HtJVH1LjjjL$L$H$1HD$PH HHDŽ$H$tNH$H5xIHU11IjILHD$@ZYHD$t.HD$xiHD$E1AHD$0;$Ht$@1L{uH|$ tM苀ttRHD$xE1AHD$HD$0HD$xE1AHD$HD$0H=s H5,1AQ5# L$XDD$(H$H$H$H|$P蜣AZA[HD$0I T$Ht$8LVHD$E1҅AE1F<EDL$LD$8LH$H$Ht$xd묋L$HT$8LH$둋L$HT$8LH$~IH=s H5&1E1HD$DD$HL$PLH$H|$H5ll$LD$8LHT$PH$H$A|HrA%HeHDEH= 1H5|Mt&L賧LHHNH腩$DL1IH$L$H$H$|H$肪H=; H5_H$H$D$T$H= H詺H= H5,6H$H= H5H$H= H5&H$wH$JLҎ9L-H$HH=V H5VD$1L$H=/ H5=sH= 1H5\$XS E1HD$Dx $|H= bH5$H= H5MH= D$HD$xHt2L$H$HLH$H5]HD$Ht$HL$ HT$pHL6H5WH$HtHHL軞tkDL$LD$811H$LE1趼HD$H= H5?ADL$E1111Lq H5H=~ E1AHD$H5ɘ1H=H LE1H5'AHD$KH5tfZD$@t H<$L$@D$1V15 HL$PAL$XH$_AXIHH$Ht HLdH$H.IHH$HHD$0LD$0HHL  1H鋔$L$~L$HHD$0L-~ LALLHE1H= H5ѫ4HD$HD$0T$H|$@\HD$0IHD$xAHD$HD$xAHD$HD$0DD$H4$1L$:HD$E1AX$L$Ht$@1LsHD$0$tL$HD$E1A1X1HD$0jfAWE1AVL5 AUE1ATIUS1HdH%(H$1蟩LLH$HtH-QDŽ$DŽ$DŽ$Hy lD$THD$(IDŽ$DŽ$D$8D$|D$PD$$D$xD$ D$D$D$HD$pHD$hHD$`HD$HD$HHD$@HD$XHD$0f.Kt'|wHcDH>fD1YH= L1E1H5[ E110HD$H= A%L蝂H$萅H蘆LH|$覚H$dH+%(~ HD[]A\A]A^A_f.eHD$E1E11U@D$8D$TH AHD$pH AHD$`fH AHD$hyfH HD$@_D$xK\$P<@\$$,@CD$ f.CD$fCD$fH HD$HH= H$jfH HD$XH$H= jwfH HD$0_H$fDLE1E1E1跃1HD$H HD$H=1 /AD$fCD$fD$|H= H5H$赩H$HD$(lH5c萩HD$(Jf.A5DDŽ$ H|$HtH$Isv$H|$0H 4HHHD$E1E~H|$@H|$H4$H|$@H 1IH$H|$H11E1L }HE1HLHH$HD$0yLIdH|$0*MHLFL$x ALd$0D$ED|$@3DD9d$D9d$ D9d$$AD9DD9d$D9d$PxD9d$E9utH= H51HH2oH= H5H1eD$LD$pL$THT$ht$8H|$`HD$IH[LH谘IH]诓IH=Ht$11Hr$HRLHIHH~H&LI˗MHLwLAlEH= H51H=q 1H5̎HczHHRzHT$(H=> HηH=/ H5P1yH= H5f1_HgHT$(H= H胷H= H5P1.L5 L= HH$LHLIƃtH= H51$H=z  LH5111ҾXHH=D H5II1MH=# H53oH= LLH= H5O1CH6H= H5ԌH谍HT$H5_ H=YLd$0D|$@$H|$X1ɾw\IHD$|iEX$HLxH=C H5[H$H$H$HHHD$8蚇H$E1L5mH= H5JH1#$H\$HH\$8LIύU H= L9и:+E1H$9ʋ\$HLqH=a H5t譫PH=I H511H$HrH$HcHRtE1F=l tHV HLirH= H51E1E1謯eH= H5XE1H= H5pE1֪LE1f|H5Ld$0E1譪H=Q H5Ld$0E1aH=1 H5Z1sGH= H51E1V*輞H51E1;fDAWE1AVAUL-x ATLU1SHTH8dH%(HD$(1D$$D$ 3`H$HD$ItAƅA"A|EFAwJcH>AwDZuAE1E1E11HHLvLmLzHD$(dH+%(`H8D[]A\A]A^A_ÐA=DHT$ H= `fH= LH51SHY HD$HtcH5< H脋H H$HT$$kfDLE1E1E1?yE11D{HHuE1E1E11AD1x)EE116IH%uIH%诟M} IW(IEH$蕟H$I?HBMt%HHIGLfH IHIGD$H8z9D$t$H蒥H5jHH$诃HD$HrH|$111rIHuC&@LH0IHtLH$豉L $ILsLyuH|$@L(D$>T$$H<$1ɾrHHD$$=H= 1E1E1H5yAE1"H= &qLirH|$诖L藒H= 1E1E1H5vAH= pfE1AXE1AJAE1<111HIM6E1E1E1A 1H.ID$T$ H|$1ɾw輖IHyD$ tS=t;D$E1H= H51AH= oLLD$LL虉D$.H$H=c H5%1H|$K14H$H=4 H5ڄx1!1 nDATIH5xuUSHoHH?iHt []A\DH5H!iHuUHDPtHz H={ HùHHtkHSI<$H51AD$AD$t#I<$H5'O1[H]A\5tDI<$H5E1AD$H{dHu3ff.fAWAVAUIATUHSHH(Lt$`LT$hEÃMLLT$MLT$tLH5H1LT$LH5׃H1E~CEuL=0IL-5NEt LH1H1LHL9uH(HH5D1[]A\A]A^A_vfDMvLLH5H1SqfDH([]A\A]A^A_DLLT$EqLT$HHp.NML1f1ɀ8 HHI9uL LT$H5eLLD$LL$LL$LD$HLT$I1fDIHM9t,AHHI4 uI\HAA nM9uAAtjE~/AEL-LLtfDLH1H,I9uLHH51H(LN[H5]A\A]A^A_q}H5āH녺LT$H5XLT$HIt4A$SLLH5 1H= LD$naLD$LѺH5 1H= Ga% ff.fAWIAVAUATIUHSHHH$L$DD$H$HD$H$DL$L$HD$L$dH%(HD$81HD$ fD11Ҿ Lfu11ҾLfuX HL踖yH== LH5z1|HT$8dH+%(HH[]A\A]A^A_@MH1ҾxHL$0L fH|$01HT$(iL|$(I XH|$0HT$ H=HT$ AVHLt$LL$DD$(L$aX1ZM=Ht$ LD$H~ǶD$fD1ҾxHL$0LTe$H|$0L萙!H5|L1EH5=L1*1D$LcLl$ = 1ҾxHL$0LdHT$ H|$0H HT$ IH=o H5~10H5)LL|$ 辺HHI{H=# H5tg HL}HcиHT$ XH5LOHHtnHH= H5>~5H= H5C~IH }LH5 1H=8 ]H }LH5 1H= j]DAWAVAUATIUHSLHHL$H$HHt$(DD$ H|$ L$HD$L$dH%(HD$81HD$0HD$(HD$ iMHLD$(HL$ 1HL|$0LXÃH=i H51覿L%|LLxHt$(H|$ L訳HD$8dH+%(HH[]A\A]A^A_LD$(HL$ LHHc$^%H5yL1E1aLD$0H5}LLD$LD$HILD$(HL$ LLHWtdH=] H5{1蟾f.H=9 LH5q{uH5r{L1E1\1DAVLL1jLL$ DD$L$HT$@XZDH= H5J1[H= H5{1E18IH zLH5 1H=?ZDAWAVAUA ATUHH5SH(dH%(H$1HDŽ$DŽ$腶HD$(HXH}NZH$IHtLeL=3d H0WHDLH, 1E1ROD$0H_D$lID$@D$pD$8D$`D$hHD$HHD$XHD$HD$PHD$HD$HD$ ;ctO|wHcH>==~ƉoN/bufDHcY AHHT HH8HD$x~1LxHMuT$t~ktgH= L11H52E11E1轻AHD$HD$0HxD$tD$[Lt_MD$H$LXD$LH5| H=ņCH= LH501HD$1E11HD$0AE1E1H= DT$8aDT$8H|$( L%wLDT$8ڮLRH|$LsH|$0dH$ gHpHiH|$H|$LLrLH|$ cDT$8H$dH+%(g H(D[]A\A]A^A_fD$hsD$hcL% T@H=i 1D$l4@H|$tH5= H|$x ffDH|$\H5 H|$Sx6fDH HD$PL- @L-v@H= H5v1H H5H$DŽ$H$^H=q H571軸HD$1E11HD$0E1E1E1@LxefDD$@H- D$p@H HD$H- @H HD$XD$`D$8D$8sD$0cH=y 1Ҿ-BHD$ CH=Y H$WKzf.H) HD$HD$@H- H|$Hu L$@tT$01D$HED$ H$\H腧I}HuIM HD$`D$*H|$Ht1DT$0KDT$0HHD$O|$8#D$8t D$8H|$X1ɾwDT$`HD$0HH|$PDT$`IHD$p$DT$XGLD$ H11L SlDT$XHDT$`HLH$PHiD$XDT$`1DT$`eDT$`HHH|$PH$E1E11Ht$PH$DT$`HDŽ$~1H|$DT$`t]H\$`DT$p7H|$ďH$HH$\zH$dH|$d9|H\$`DT$pHt$P11DT$`H$FH$H&HDT$`MtEH$LDT$P'`H$LWHDT$PHHHDŽ$D$XHDŽ$VH$HߋD$@H$DT$@H$H$H$I_hDT$@E1H|$t^HH\$@DH\$EI/HUH$HHD$PxHL$PHb9|H\$@LEH|$HD$@E1HD$P|$XE1St$lL$t HD$8HDT$H~DT$HHD$`HD$xD$pLd$xEHD$HcPILHt$hD$PPAUDD$X$H|$PpH tA11ҾLUD$pD$pHD$H9D$tHD$HlLH~UHD$HT$XHgP$t$pD$XPAUUD$DD$h$H$Ht$XH|$`H0OPfkHD$HySHD$HHD$1E11HD$0AH= H5^1DZH5` LDT$0nH5W LO]DT$0HH҉D$8H= 1E11H5ZAHD$0cH= 11E1H51*A=)=~ʉ:uE1E1E11"wv5tOufHc AH HL(MO1HH8u7Ht$0LFHD$0HcЉH9.~k8OED$H=r 1E1E1H5zE11詧JHT$ H=4 :;fH=) L1E1H5E1E11]H= A[NHsLPL]H|$(]LaHIHD$8dH+%(rHHD[]A\A]A^A_$@D$H=i 1Ҿ1HDHI HD$H1 HD$HT$$fDLE1E1E1OSE11 DU qU aAUDAEDA5DD$#D$1QQ65ET$L%<HD$HtH=B H1H5x聥H H= LxLH5xIHH5 HNT LbD\$LEqhH5 yBLLE1E1`HD$(HHLH|$(mIH2H|$('[HD$(1ۋT$ H|$1ɾwrIH<$Rt$E1L$|$ HfLH*HEE11gIHLHU`LE1T$$H|$1ɾrxqHH]Hl$L%6;Ll$(L5Zf1H57*|$$LIDIEHE1jA15AYAZHHHH~u|$$u fA<$DHt|IHl$L[Ld$(MDD$EH5L軉H5w_H|$(IHjE1E11Hl$,[A|$x11ҾHE_HL%`ZLH5 H=u1)+$菑H5vDLşLLHD$(HHL虏Lt$(LH5vH= 1E1E11/LH5!K;D$LL_ H= H5uH`LD1D$AL%(H5vH=h 1E1E11詡GH58LLt$(HD$(H H= LtEIHH0;H= H5rv131ɺLH\aLH= H5Yv1E1H|$(H5^\GH5uH=v E1E1E1踠VH=\ 1E1E1H5 u蘠6pH=7 H5u1yH= H5Nu1_E1E1ff.@AWE1AVAUL-A ATLU1SH0HdH%(H$1H+HDŽ$HDŽ$HDŽ$D$|D$xD$tH 2D$(D$ ID$8D$<D$,HD$HD$HD$0HD$ @F;|PwHcH>HT$xH= 2ufDH= L1E1H5E1E1E1LĊLlHLDUH$HH-]H$0H#WH$1HWH$dH+%(6HD[]A\A]A^A_fZ+E1E1E1@D$tD@1AJH$L:tDT$ EDd$(Ht$H$H$H|$AD d$,6H=X H5\1蚝H$t$|L sH|$ IRIMH55Lڃt$xH|$0DIH]DL$,Et%DD$ 11LHECnCL$8T$B=fH= 1Ҿm%HDH HD$0H HD$ wHT$|fDLE1E1E1GE1H9 HD$/H! HD$L= @D$(D$ D$8D$,D$<Ht$H|$H$H$2tEH= H5X1E1ؙH$t$|L D7H|$ IOI9H=T H5W1薙OH=: H5WE1E1x3H= 1E1E1H5WXH= \@H$LH57HDŽ$$CLH5W1 H$L;ULH5D1H$vE1<H|$0E1VZH=_ ?eH Dt$ H VD t$(HVHEAHZǃ|$x *H= E1V?hH= HH5V&H= H5m1 HHVbH= H5VH= H5Um1ΗfAWE1AVL56 AULE1ATU1SHHHdH%(HD$81D$,D$()H$HD$ID$@ >Džt= l| wHcH>D=ADžuHc9 H: H L1MJ1HHH8uHL$H\$0LH5t^HD$0HcЉD$H9HL$x@HQHHHT$t5t(HD$0HT$HcAH9H= L1E1H5cE118H= A6=E1H?LSL{LLsLH+HD$8dH+%(HHD[]A\A]A^A_D(l'_E1E11jfA"4fA%DH H$H= 1ҾHDD$^ N H HD$HT$(H= (}DHT$,fLE1E1E1AE11D1@9D$An%H H= H54gH55jIHD$='@H5 L<=U L]QH5jt$LrWH5jkE~DL#HLH5L,IMt$(H<$DPHH\E|$(T$EEL裀H H= L]7IHH9q c T$H5LhIH|$(H1HE1jE11HE1S[Y^@/Ht$0L1bHD$0HcЉD$H9u ILH5 H=se1'H5iH=! 1E11e(t$,H|$E1LQH LII{LH5U+T$H= 1H5h H= H5Q1H= 1'H5g֑111LHQ+EBD${LHE13FhH=4 H5i1v9LH|aHHE1Y!H= H5i1/H= H5h1AVIHAUIHATIUSL*M11HLH>IHtH8<_HJHHMt$LLLAA[D]A\A]A^DE1[]DA\A]A^fAVIAUIATIUS4fAl$I\$@,_HDh IM9wM)I(:=l? KHH= 1L ATA& H /Hj(H5gj(̏Ao$H ) AoL$) ID$  H M9v\I\$2fDM)I(wW)LLH=] 言B0H+MI@,t(^HDh tVI9r[L]A\A]A^D=> Ao$) Ao\$) ID$  H M[]LA\A]A^ù)LLH= B0H LH bff.AWIAVAUATUSHHL.<$dH%(HD$81Mt0H= 9H 'H[ H<H)L1}Hy H $XAu^fDEA9}PIcEl$ILPWL- ALD%'H=ϳ DH5g}IH&H= LRH H BH8tVvN=2 ~EHH5BH=% L ; HDHA4 H5oP1RHQLEH ? LL;H= H-۱ NHpCHHS E H=Բ H- 0HsHHP H|$L- =2 L&8IHb H=۱ H-̱ HtHtHjc+ H HLO H5 H|$HBSŅ+ H= H-а 賁HHHQO =[ L-ܱ x L@Ņ D$D$91 L,$E1L1ҾLE1j6L- HHD$A1Ҿ1Ҿ11ŋ= ;3t8=0 U1HaHHL@,LpHHHRH5/ HA:vL- fD=!0 ILHHL A;PH H9SH5YUH=; kH=% ]H= OH=! AH= 3@=/ mPHtH= L PApH PHPH5YP1H H=Y .u 1=$/ AHHHH=V L PAvH ݮH2PH5ZP1zH HHH= L HRAH H5RH3P13H 0-, CH=$ =g. AHHDH= L PA~H HuPH5YP1~H DHHH=J L hPArH ٭H.PH5XP1v~H HHDY EuH= H5 H= L5]tz5LpHoqIHlhID$HHAD$PHHL 0LHPH"LۈPH 3HsAYAZGHDH5 H7)HUgL=֫ IML(LLM8H= HH5<IHt]Hz HtH}(HH/Lj(LLLS(_HeLHpH= 0H5 L= Ht(L * H MZLLzL=ê H=Ī HtF5A LL?ZLW IHHL7L2L=q MtL'LH.H=J HHv;1 IHyHLffL H= MtIH HH8ZL4IHLHQML-H=` H HtwLZL-H11LYHIt(HMtL&_HLHMoHhHHHA+EIH H&LZH= LH11LYHI'HMtL&_H(LHnHHHHAp+EH= L=q Htd5& LLYL<IHH.HHLdsH{s0L{Lg0L= MtLS%LH,H= HtUH EY11|+IHH8.HH;L:WH{#'L{L'Lx H=Q MtIH M HHXL2IHHHL*vH= L MtIH HH8L62IH>HHOLe*!H= H Ht~LXL{H11LmXHI%HMtL#_HLHlHHHgHAL)EH=$ L=% ML5XLL11LXHH4%IHtHd#_HvHH lMt,H`,HH7LLADL(H4,HHt7HA1WH=[ %|qH=@ #aq1=& AHHH=է L  PAH \H|PH5RP1vH H= H= =-& AQHAWH=a L PAH H=|PH5 RP1vH L?IHtH= IHuL,$A1H-q L%] 1Mt/LH5aH H= H56HpIă=H% 4P1LE1UE1LL:>ZYLhBH0LoL- HHH=1 L OPAH H{PH5VP1]uH LHt$Lu(ŅH5d H5LUBŅL,$AHIUH= L PAH $HyzPHVH5rVP1tH H= -H= H^=# H=֢ H=â 8=# HQH= L 5 PAH HyPH5QP1 tH k=i# APHIH= L PAH %HzyPH5*WP1sH IHWH=R L pPAH H6yPH5.VP1~sH 5| =" HQH= L PAH HxPH5,VP1$sH H= HUARH= L PAH /HxPHTH5UP1rH H HtT=" HAQH=@ L ^PAH ϡH$xPHLTH5TP1erH H=Q t\=! ~SHAPH= L PAH uHwPHSH5TP1 rH4 H @H$ 4H<ASH= L PAH HkwPHSH5SP1qH BHT$0Ht$(LiELt$(MF= H=ʠ H5v1AH= HH5i1E1_AL- AH= HD$0 H= H- L% HLH W11"IHTH=R t9H=P t/H:LI9LH9t = HL$0LHLAƅL\$0M8L-ܞ M= L\$H`L\$HIiLlHL\$G? L\$=uu^=eLL`Pt[LT$[HHtML%W M7E1= L ARA LSHtH5TSSaE1E1E1LLH=Ν HD$ HD$(HD$0 H- HH5 HHTSwHHHL$(HT$ HLLD$01AƅtVH|$ oHH5> H|$ Hb-m>E1H|$ H|$(H|$0H|L-U jE1= cAVH= L1SL Ad HrSH5QS-mH )E1=z L PA` LSHrH5dQSSH,RL LSA H-rH5.UAUPH=l 1lH 1= NH,L QA SLHqH5nTPAUHh,L\$LH= VL Q/A HqSH5SAUP14lH L\$A}=t <L- MtH5+L#H=) HT$\*ufDH= L11H5|E1E1E1MZH= AKHLH|$pqTLE1BLJGH2VHl$hHtH`HHH NHl$`HtH7 HHHMHD$xdH+%(HĈD[]A\A]A^A_z1E1E1E1fD$ 1A.H<$Ht$p\$(Ht$H|$HL$`HT$h=H= H51E1XHL$ht$\L :H|$ IIMVt$XH|$0DH= H51SH= H=u H5VZE1E1SaH=W H5ZE1E1SC{H=, 1E1E1H5%hSH= H5ZE1E1JSH= H510SNH=ԃ H51E1Sy#fATIUHHH=? tUHt@6H=, Hl&u(H6HLH5H]1A\RDH]A\HuHHLHDHHDH1]A\HHH5XRAWAVE1AUE1ATE1UH- SHHHHdH%(H$81D$|HDŽ$HDŽ$D$x1D$D$ID$D$0D$D$8D$4HD$ HD$(H$@CK |wHcH>HT$xH= ufDH= LH5H1 Q1E11E1E1E1H= AH<$DD$ MH$SH$FL>L>L=1L@=F o=GLD%r u1DT$hEt DL$XEuD$hH$HIqH$H0 DŽ$DŽ$H|$0HtH$H$ L$@E|$xOD$@I A? D$xPDD$PE D$HD! DŽ$AL-YrL9IHLH9IHH|$ H|$1ɉھr HD$0H|$0 H|$! H$H 1MHD$HHD$HD$H|$81Dw HH$ L$H HD$0H\$HHD$8H$$E1 H$HHVHD$HHDL$dH$ER H|$HT$hH$HH5 |$X# H$H$D$C9L$hHD$XH$UD$D$`PL$DD$P$H|$80_AXHcT$H$@HHT$/HT$LcD$XH$HtL/L9t$H$H|$MH|$pD$t,H$8…H=n H50G1A>H$H$H$H$>H5D H$H_HHD$H|$   H=ln H5F1=1D$PHD$HD$D=!=>/]DZ 8H=m LH51(=H=m LH50m1=HD$E1HD$HD$HD$8D$PHD$0E111E1H=om L%9H|$ IH|$H|$57 LL LLH|$0 HH L H$H$6H|$811H|$(G8H|$LH$hdH+%(4D$PHx[]A\A]A^A_D$TD$T{HIl H$d@H1l HD$8OH=l 1ҾHD$(+Hk HD$H=k H513;Hk H5H$DŽ$H$H=k H5E1:HD$E1HD$HD$HD$8D$PLfDH9k H$HHT$ht\H$HT$hHcH9s9NЉT$hH-ql @L$@'D$XED$@D$XD$@f.Hj HD$0Hj HD$pDŽ$D$`{DŽ$hD$d[D$dKDŽ$8D$P+D$`Hi HD$HDŽ$Hi H$@H=i 1ɺrpHHH5Hk H$H$D$jT$ eHcH k H5k HHH)fD@HH9/P t tHj HD$Hh HD$H=h H|$x1H|$x~HH8kuH=h H$T$xH$HT$xtHH9H H$D$xnfDD$H[AMDH5+HaD$HAŅtRE1*f.H|$ t?H5g H|$ 'H=g LH5ʱ17 f1D2HD$ HuH59g H= 1[L$xAHcHiVUUUH )HcHi*H#)ȍDP)Hc$|$`zH=*g 11E1H5I1e6D$PHD$HD$HD$8HD$0nHD$H|$H$H|$HH$H \$ L$THH\$HLd$H$ɉHEIH$HMHH1$AHLpuA>H\$Ld$HD$Lt$0D,=DŽ$DŽ$T$xH=e H5ү1 5 H=~b HD$0|DŽ$D$TEAAہ&H$eLH$IH$}D$EDT$TErHt$HLmHD$HH$HD$8H$}D$ThH|$8H HD$HHD$0H$H- L|$0HL/HH/H5pd LhH5ad HYH =d H=Fd L1H53`HD$HD$HD$1E11HD$8D$PHT$0H5c H=谻 |$X1H=c H5;1 3H$AHPH$PD$HL$H$H$,Y^H5!H=dc jH#HH1H$H_$T$Hb LMH=b HD$HHH|$ HOHHD$@Hb H|$HT$0LD$@HT$H=ib Hq(H|$@HD$H|$:H$+H|$pLc$1ASjDL$dHT$ H$H$WA\ZD$E D$EDD$`Et@|$d'H$H$3+|$`Ht$HHH\$@H$HD$HHl$Xl$x11Ҿ Hu11ҾHLHAą$u_11ҾH\$@H$Hl$XGH|$HDLA9tTH=` H5150D$PbH|$HLA98H\$@Hl$X@H\$@Hl$XH|$H11Ҿ xt$P H|$0+H=n` H5H1/HH=N` H5H1/D$PHD$1E1HD$HD$8D$PH\$@H$Hl$Xl$xHD$HD$NHD$D$7H|$pH)t$2D$H=_ H51H\$.HD$1E1HD$HD$HD$ HD$8D$PL$T"H$H${u>HSalted__H9$xH$T$hH$HB;D$hH5H=^ 11.D$PHD$%H$LH$H|$pH$H5iHt$0H|$8H\$HH$H=-^ H5 aq-HD$Dd$TH=^ Et;H51D-Dd$PtH5 H(H5] HH5Z1 -D$P6H5 H(H5] L`$1HD$HD$D$PLx&HD$HD$D$PH$b|$H|$pt H$HD$pDL$TLD$pH$HT$(H$H$HD$HD$H$H5 HH=\ 1+H=\ D$PLqTH=e\ H5+D$PH5} HIJ'H53\ L+]D$H1E1HD$HD$D$PH$1H5ߦwHH$D$9%11҉D$XD$H ʥHH5>[ 1H=esJH H5[ 1H=?sH=^[ H511*D$PHD$HD$D$PH$HT$PHT$Ht$hH$H_H5~H|$`H|$HH58uT$hH|$HH;D$hH5MH=Z 11)D$THD$D$PH5U%H$ H5!3HH$MPLH52D$PH51E11 B$H51IH$D9ο 1H52|$h~YD$hH$Ll$XL%IHH˃HHD$@L1HH9\$@uHLLl$X q WH51E1V B$H51I4H$g"D9ο  (H$ Iff.AWIAVIHAUIATUSHaI.IHPHT$ CT$ H~HDA;Hc۸, HfHkLHH[]A\A]A^A_f.A;~A$HAHAIL% L@0A7HchHHI.AAIH5X0ALcL3 HHuH LH5:W 1H=aof.HHIL%gL@0A7HcHHt I.fI>JLI1fATUHSHHdH%(H$1H9t&H$dH+%(uTH[]A\HIHȢLH1THsH{LuCBfAWAVIAUAATUSHdH%(H$1 H I IpHHD$MMIIvH$Hu'*@H0IvIAHt>-uH$LDHa E1HOIE1LD$ D$@G|wHcH>H$H=]U H5T1$$H=AU H$LLH|$H$dH+%( $Hĸ[]A\A]A^A_fDD$ ABf.PcA9AMƃDBD$ H=9 $@H5iT L@H5IT LHcS HS HH3Hu'NHXHsHHt)>-uH$H=S H5,1H2#HvH"D$$H\$$Dl$DDt$8Hl$Ld$(L|$0DH|$9D$$Qt$$H|$6HIHHHwLH5HH1"Ht$(HHH8LH]uDl$ED\$DEDL$8EE111Ҿ HE111Ҿ HLcE:HD$HHE1HHD$PDt$~H|$L|$LLL1H=G AWE1AVAUL-r ATLU1SHTHHdH%(HD$81HtHD$0HD$(HH D$ HD$IHD$fDKAƅtD$ Aƅu@H=ԓ<HceF HfF L$ E1E1E1D$ cA'AJD:A D踢fDH=AF L1E1H5EE1E1wH= F Au1LLLH|$0HdH|$(H5’HD$8dH+%(AHHD[]A\A]A^A_L=G T@H=yE 1Ҿ-H5DHYE HD$HAE HD$LE1E1E1oE1Ht$0LMHt$11HL$(OHRLE11LgHٺ4H|$I,IHL9D$='H[D H=\D LIHL0LL$ T$HL3IHH1E1E1t$0HT$@HLZYH=D H5yTH=C H5F<"E1ALaH=C 'H5.1H=C H51E1lH=C H51R4@AWE1AVAUL-8ATUH-g SHHHD$FDsAEA w%KcDL>HT$H= C H5 1KHT$H=B 1AH5QB+HD[]A\A]A^A_fAf.mAHE1žAAAAAAuDAeD1YAEt3DzH=A H5HHH̎HD1HT$H=A H5Ύ1AWL=AVL5AUL-!d ATLUH-SHtHHdH%(HD$81HD$0H$HD$IHD$HD$HD$ D$(.~BaHcH>DD$(fD=D=@JtH=@ L1E1H5@E1E1E1H=@ 1AHt$HLDD$(H|$0LLLLDHHH|$HH<$HH|$HDD$(HD$8dH+%(HHD[]A\A]A^A_@=EH<$uHH? H|$0LkH$H~fH|$oH>HW? H|$0H5N&HD$H8H)? HD$ H=? 1HHD$fH|$0H2H5> &!fH|${HH> H|$0LzHD$HLE1E1E1迺E11E1fɚQE1E1E1E1Hc= AH= L4I6Hw1LHXHHuDD$,TH= H== YDD$,HICHDD$, IHGH|$0DD$,tALH|$0H*IHAHL膶>L,DD$,|$(H|$ wDD$,1Ɂ+IHH|$DD$,H|$DD$ H5>DD$ HI`HT$1HLDD$ DD$ D$(DD$ T$LLDD$ D@KHD$0HHIH=< H5ˉ1 E1E1H=v< H5Љ1E1 E1E1H=I< H51E1 H=1< 茲LE1Q+Ht$LHHt;HH5L1C E1kH=; H5f1& =H=; H5<1 HT$H $H5?; 1H=fSff.USHHH>H;HHH[H]ff.@USHHH>諥HH;H蘥HHH[H]?ff.@AWL=: AVL5: AUIATUH I肹LLLIMtL?Hu]A\A]A^A_fHLH]A\A]A^A_AWAVAUIH=ATUSHHZH=9 IqH=: L11H5އL-]uX H=9 LH5L5PuL3 LL9=L{H5\; HHt HtLIHtHLHBtH=o9 H5.1H=Z9 L誙HңHH=;9 H5H1: DHHHtH=9 H51OHHHtH8t~H=rHEHHtH8H=tHHHH8t_H=a@H5ٶ HL[]A\A]A^A_H=\8 L1H H5;aH=/8 L>1H ˅H5f1H=8 L1H H59-@H=7 HH5s1[]A\A]A^A_ DH=7 LH5f1H57 H==_UHHt#HH57]H1fHHH]HDHHD1HHH5sUSHHH>{HH;HhHHH[H]ff.@AWL=6 AVL56 AUIATUHZIbLLLIMtL_Hu]A\A]A^A_fHLH]A\A]A^A_ AWAVAUIH=ATUSHcHZH=5 IqH=5 L11H5L-=q8H=5 LH5L50q+L LL9=L[H5<7 HHt H褠tLIHtHLH財tH=O5 H51H=:5 L芕H袶HH=5 H5H1b6 DH HHtH=4 H5Ă1/HHHtH8t~H=RHHHtH8H=TgH?HHH8t_H=A@H5 HL[]A\A]A^A_H=<4 L 1H ؁H5saH=4 L1H H5F1H=3 L 1H ~H5-@H=3 HH5S1[]A\A]A^A_DH=3 LH5F1H5q3 H=蝾_USHHH>軝HӿH;H訝HHH[H]_ff.@AWL=2 AVL52 AUIATUHI袱LLLTIMtLOHL]A\A]A^A_fDH]A\A]A^A_ff.@AWH=AVAUATUSH覿HMH=N2 IH5x11L-mL5mH=1 LH5LgDLLM9=LH53 HHt HtLIHtHLHtH=1 H5^1H=1 LڑHH H=k1 H5CH12 DH\HHtH=51 H51HHHtH8t~H= HHHtH8H= HHHH8t_H=~@H5 HL[]A\A]A^A_KH=0 L 1H (~H5k~aH=_0 Ln~1H }H5>~1H=20 L 1H }H5~i-@H= 0 HH5}1[]A\A]A^A_=ff.fUSHHH>;HSH;H(H@HH[H]ff.@AWL=K/ AVL5J/ AUIATUH:I"LLL贞IlMtLHWu]A\A]A^A_fHLUH]A\A]A^A_AWH=AVAUATUSH&HMH=. IH5}11L-jL5jH=~. LH5LDLxLͬ9=L+H5 0 HHt HtL舻IHtHLHrtH=. H5ބ1iH= . LZHrH芺H=- H5{H12|/ DH̺HHtH=- H5{1H跣HHtH8t~H="]H蕝HHtH8H=$7HOHHH8t_H=T{@H5A HL[]A\A]A^A_H= - L1H zH5zCaH=, Lz1H {zH5z1H=, Lk1H NzH5z-@H=, HH5#z1[]A\A]A^A_ff.fATUHSHH>H;ILH$t[]A\H}?H觸H;H,H蔸[H]HA\5DAWL=+ AVL5+ AUIATUH蚥I肪LLLTIMtLHǮu]A\A]A^A_fHL赹H]A\A]A^A_AWHfAVAUATUSHH5=HXH=/+ dH%(H$H1)D$)D$ )D$0)D$@)D$PVHHHH躤H=* H5EyH1"HHRH=* H5xH1HRHxt HϏtHؘHxHDH=g* H5x1HIIHH8HH-xL5wL%Xf.I(I(HHtAGƒt + tID$HL$`AGHT$wHLl$HHL$ LHT$(HD$0>vLD$L1H5x覐T$1IcL>DH$HdH+%((HX[]A\A]A^A_HT$(H=) H5w1^fHT$ H=( H5&16Ht$LctwHT$H=( H5Fw1Ht$LtGHT$H=( H51w1`HD$ H=l( H5H1>fDH=I( H5v1fDHL$(H=$( H51n@USHHH>{H胴H;HhHpHH[H]ff.@AWL={' AVL5z' AUIATUH芨IRLLL$IMtLHu]A\A]A^A_fHL腵H]A\A]A^A_鰔AWH=AVAUATUSHVHH=& IH5u11L-AbL5Jb5H=& LH5LDL訾L9L[H5<( HHt HtL踳IHtHLHrtH=O& H5}1H=:& L芆H¦HHD$襙H譲HL$H= & H5tH1P' 2HZHHtH=% H5s1H西HHH8t0H=swfH5q HL[]A\A]A^A_3H=t% Ls1H sH5SsfDH=I% HH5r1[]A\A]A^A_}ff.fUSHHH>H蓱H;HH耱HH[H]ff.@AWL=$ AVL5$ AUIATUHIbLLLTIMtLHGu]A\A]A^A_fHL蕲H]A\A]A^A_`AWH=AVAUATUSHfHH=$ IH5r11L-Q_L5Z_EH=# LH5ϷL'DL踻L 9LkH5L% HHt HDtLȰIHtHLHrtH=_# H5z1H=J# L蚃HHHD$H软HL$H=# H5qH1`$ 2HZHHtH=" H5p1-HHHH8t0H=pfH5 HL[]A\A]A^A_CH=" Lp1H pH5cpfDH=Y" HH5o1[]A\A]A^A_ff.fUSHHH> H裮H;HH萮HH[H]/ff.@AWL=! AVL5! AUIATUHIrLLLIMtL迯H'u]A\A]A^A_fHL襯H]A\A]A^A_逯AWH=AVL5\AUL-\ATUS1HfH= H58IHLULL=9LH5|" HHt HtLIHtHLHRtHH= H5toHD$1HT$H6H=_ H5{1H=J H5m1H=5 H5+o1H= H54o1jH= L[HH苬H= H5mH13}! HHHtH8H=HHHtH8H=mYHѣHHuH8tvH= 3^fDH5ќ HL[]A\A]A^A_1LHH= L1H lH5lNJH= L1H lH5l!H= Ll1H YlH5lff.@USHHH>HH;HxHHH[H]ff.@AWL= AVL5 AUIATUH*IҜLLLēIMtL诙HL$]A\A]A^A_fDH]A\A]A^A__ff.@USHHH>{H#H;HhHHH[H]ff.@AWL= AVL5 AUIATUH:ILLLI H5fu1EH[]DH= H5(1[fHHH^H5i肳HUSHHH>{HCH;HhH0HH[H]ff.@AWL=; AVL5: AUIATUHʊILLLI\MtLHu]A\A]A^A_fHLEH]A\A]A^A_@AWH=AVL5>TAUL-%TATUS1HH= H58IHLD$ L耰LՖ9L3H5 HHt HtL营IHtHLH*tH=' H5n1D$ lH=  L]xHH荤H= H5eH15 ?HOHHtH= H5e1HHHtH8H=e\HDHHH8teH=#6H5 LD$ tH[]A\A]A^A_f.H=! HH5f1[]A\A]A^A_]H= L1H dH5d5HH= Ld1H mdH5d'USHHH>H#H;HHHH[H]ff.@AWL= AVL5 AUIATUH:ILLL脫IHH;HHHH[H]ff.@AWL= AVL5 AUIATUHJIґLLLTIMtLHu]A\A]A^A_fHLH]A\A]A^A_AWH=AVL5MAUL-MATUS1HƟH=O H58IHLD$ L@L蕐9LH5 HHt H謨tLPIHtHLH蚇tH= H5h1D$ ,H= LrHEHMH= H5_H1? ?HHHtH=x H5W_1HHHtH8H=__HdHHH8teH=H5Y LD$ tH[]A\A]A^A_f.H= HH5R`1[]A\A]A^A_H= Lw1H Z^H5^HH= L^1H -^H5p^'AWAVAUATAUSH(L=> dH%(HD$1HD$M1L5 NL- ԎH= LLHD$H|$HZMM~8I0MtmA9utH= E|$utH5=]1H= INT$1I0H5^M~MuE=HD$dH+%(H([]A\A]A^A_f.L- H= LL2HD$(H|$Hu^MLmVHHL-{HIVH5zn1{fD+fDMt[E1LH-N fDEw A9DLH}8H0HuܸOADl$AD$fHD$dH+%(u^H= H(H5[1[]A\A]A^A_=DL`iHHL0uHmff.fUSHHH>蛸HH;H舸HHH[H]韽ff.@ATIUHH uH]A\fDHL]HH]A\f.AWH=WAVAUATUSH&H%H= IH5\11L-HL5HH=~ LH5T߅LDLxL͊9L+H5  HHt HDtL舙IHtHLHztH= H5b1iH= LZlHH芘H= H5YH12MDH5A HL[]A\A]A^A_kH= HH5KY1[]A\A]A^A_DAWAVE1AUE1ATL%JUH-) SHHHdH%(H$1 lD$HH$D$DD$4D$8D$<D$@D$$D$,D$D$0D$(D$XD$`D$hD$pD$xƄ$D$|D$tD$lD$dD$\D$LD$TD$D$PD$ DŽ$D$螀fD#$HcH>L-WH=? L1@H@@#H= H5W1RH= H= L%W1L,H= H5Y1r@ @@@kL$4D$LT$D% ЋT$H% AĨH H=_ H5W1H=J H5VZ薴!HHt5HhfH8H= HH1dH܆HHuAH= H5V15H= H5Y"H= H5YH= H5YH= H5YH= H5YֳH=w H5YóH=d H5Y谳H=Q H5Y蝳AEu)fDH$H=) 1AH5eH$dH+%( HĸD[]A\A]A^A_fAf.Af.}31AiL$D$PAT$TED  ȋL$L ЋT$\ ȋL$d ЋT$l ‰T$<kR D$<D$PH=KIHH= H5A11L-T1H= LH5;LDt$L@L9 L[L5< HMtHTLHiuH=H=^ H5TH1HmHՒH=6 LH1  kH+HHtH= H5S1NHmHHtH8_ H=m訷HHHtH8f H=o肷HzHHH8H=SXaABD$A}D AcHE1UD$4A@D$ A-DD$ ADD$AD$ADŽ$DH AH4 D$HAD$8AD$<AD$,AD$XApD$`A`D$0APD$hA@D$(A0D$pA D$xAƄ$ADD$TAD$AD$dAD$DAD$@AD$$AD$|AD$tApD$\A`H= L= HYL5 I~8I0H?L'uM~MILL цL5͆HudgL9L9u>L9t9:t4AG -H=~ H5QD1L uL2IWIHtL9uH=A H5Q1ApD$lA`D$LAPD$PA@t$D$D$D$PL-pOLD$PL-\OH= H5*Q1H-aXHUH= H5Q1HH=i L1bH=S L1H== H5f1bH=# H5P1mhH=  H5P1S.H= H5P19H= H5P1zH= L1 H= L1^H= L1D$tXD$PH=m L11褟H=bPH1NH=HHH1~H=>PHD$.D$t+D$PL-MH= 1LJt$|D$ L-}MH= 1D$PLH=aMxD$@|$D$tT$|$  D$ ЋT$x ȋL$p  ЋT$h ȋL$`  ЋT$X ȃ ̉D$LL$,D$D$D$PD`AD$@|$@Dd$PL-yLH= 1LAH= H5IHD$1HT$HH= H5U1H= H56H1H=} H5sI1H=h H5|I1H=S LZH[HӆH=4 H5 HH1{H5?w LDd$P¾D$@|$LA\$L-GH= 1L/H= DŽ$踵HHt 8> HI{HHpL$1H5LW $ H=b L1L$(D$LT$0% ȋL$ ЋT$,% ȋL$$ ЋT$@% ȋL$< ЋT$8%? ЉD$LŨurBB)D$AL-HFH= 1LOD$D$ ueD$@AH=W L1@@V@C@fDAl1LšHGDd$PL-EH= 1AL,t$^D$D$D$AD$D$>AL-6EH= 1L-D$ ZD$@|$`L$(D$LA\$L-DT$0% ȋL$ ЋT$,% ȋL$$ ЋT$@% ȋL$< ЋT$8%? ЉD$LŨa@A\$EhAL-5DH= L1 IH 軼H賨IH T$ 1ɾ{HHT$HT$H11ɾ|LHHc$LᾋLH L@tE1HHHHtqD|$Dt$ILl$I͉\$ LfDL9LEHlA0H= H5EA H1DI9uDt$Ll$\$ D|$L^LQ@=@ @@@I H=+ H5B1uH=YIHt"1HH5}лLߌH= H5B1*L$4D$LT$D% ЋT$H% AĨ5PH= H5(B117\D$f 1HvDD|$1HD$ADt$ *fDHLH5EL1y9\$EI+II蹟L聡t11LwA9}%DxHT$H^Ic HHP LDHwxcL%~ M=LL貣*ILLLH5D1"H=9 LLH5DDt$ D|$Ht$mHzEH= H51;uL-@H= L1@ @@  @@ H= H53@1@AL$4D$LT$D% ЋT$H% AĨBH=! H5B11iLaDt$#f.H= LH5?:L/p9LH$腛HIJ~H= H5cHI11HH$H5KVhH$1o$o$HH$H5S)$)$H$ hH$Ho$o$H$H5wj$$H$(袝H$1o$o$H5jAH$H)$0)$@H$PwgH$Ho$o$H$H$x$X$hUfH$Ho$o$H$)$)$;HL萏H谐H$蛐H$0膐t0$HGH= H5@Ha=HD1L H$X7LG{HHH8H=X@5vH=Q H$H5?1蓾KH=/ H$H5?1qLDt$0H= H5<1B}H= IH= L1H= H5>?1H= H5J>1H= H5I>1ҽH=n H5F>1踽s@@@L$4D$LT$D% ЋT$H% AĨAgf.D$PL-;H= 1L#H= H58 7fDH= LH5'1H= H5=1μH=j H1H5H豼DŽ$H=J H5:1茼H=0 H5:1rH= 3H= 1H5:JMH$E1Dt$L$HD$MΉ\$ LH2\H|$LH"$覴H= H5PH1޻$H;H;HEH=e 1H5<H諻I9uDt$\$ lH= FH=+ H591E1L-V<kH$ H= LH1I$H= H5 <H1%A|tA9D+lH$H$IH$H$L$Kn$dH$H=f L1贺$H:H:HEH=; H5;1腺$)H= H5;H1aH$HH= H5b;1;D$D$PD$PH= H$H5;1 H= H5281ֹH=r La;1H 8H5Q8詹jH=M H571Dt$ D|$腹H=) H5BmH}9H$H:1HD$L$4D$LT$D% ЋT$H% AĨY?D$@AD$EA@CG`Dd$PD$D$PD`AA\$L-6A /A\$L-6L-6D@dA\$Eu.PD$gAD$EA+L-I6|$A\$L$(D$LT$0% ȋL$ ЋT$,% ȋL$$ ЋT$@% ȋL$< ЋT$8%? ЉD$LŨAA\$E談D$PD$D$ D$@|$AD$tT$|A$  D$ ЋT$x ȋL$p  ЋT$h ȋL$`  ЋT$X ȃ ̉D$LL$ND$LHHtBHu}0~2ImH[]A\A]A^A_@HLLrHHuH= LH5Q1H= [HH1[]A\A]A^A_Drff.fAWAVAUL- ATLUSHxL= dH%(HD$h1H @HD$`HD$XD$THe FHD$8vHH*D$,E1HlD$(HD$0HD$@HD$H$HD$ HD$HD$fZtw|wHcH>=1=~ʉEuH$E1E11E1dwn@tZu1AF_)DtMVH H5RLHD$HkHHHL$H1HLàHIMSHt$HLcIML赐LiH|$0L|$`H== E1E11H5]5yH$\H= HT$TFzf.E1HT$8H= 11H5GE1E1H$HzH= A YLahL)H|$X/Hg[L_[H|$H<$AH540jH|$覎HD$hdH+%(HxD[]A\A]A^A_D$(D$,` Hq HD$@oH HD$WH= $HD$H6rz` !H5 Ho E@Hi HD$0|$,mL%F H9 H$H) HD$ H= 1Ҿ:HD$L@]HD$0H HHL蠃IHHLTIHt{H= H5~1IHt^I(L5hH2L-?fDAw,AGIcL>MHdH=O H1蕯II(HuLHE1E1E1xE11H$efDL1H-MH-@L_1Hv-wDL`5H^-_DH$E1E11HD$E1HD$H|$0L ; L$,MH|$`HT$Ht$0(L|$`MU1%fDHLHIs~ZHa]9|H\$@Ht$XHJHDL$,EH= H51HT$8H= 11LH5кE1E1H= TH$H=} H520H=j TLLdD$,D$8H$Ht1HBH$HpqHȝHH11ҾH+PH|$r:qH蒝IH11ҾHOD\ E H5 LU|$,Ht$0LMIHHHx|$(2HKuT$TMtL$8Ht$LT$TtNL$8Ht$ HtXEE18.SHT$ H= H5H1AC@#E8RHT$H= H5IH1T$THT$HLL PI+H= L1E1H5).E1E1ЫH$H=l E1E11H5A訇|H$E11yH=5 L1E1H5&E11lH$LE1E1AHt$011LIH$D$T=tgu@LH,MELL5H5*LDH= H5a-1ҪE1R1LE1t$HT$hE1HsY^~\MLL^E1nD$(11҃|$,LHtYj~8HrD$(;H= H5,3|$(uH= H5,{AWAVIAUATUSHxdH%(HD$h1I HD$XHD$PIHD$HHML= L1H*5LE1H H-_b;D$4HD$HD$HD$ HD$(HD$DODž (| wHcDH>E11E1E1L=*,LLT$L\$̆L蔑H|$ H2_H|$PH|$>RL֤H|$HLaH== OHT$hdH+%(Hx[]A\A]A^A_HD$fHD$ fHT$H= 11H5JL=^+E1E1$fL1L=@+TE1E1LLT$L\$ׅL蟐H|$H=^H|$PH|$IQLH|$HL`1 I 9GD$4*fH HD$H HD$ H HD$(H= 1Ҿe1IDD@@P#9@E11L=)E1@FDeD3SfHc H HH(HbLPHMLT$8uDHt$`H'ELT$8DHD$`HcAH9A(=@a6+H|$Ht$PBHt$ 11HL$H>@H|$(]IH1H|$XLHD$L  L H-LbHL\$XLT$D E0H5 LLT$L\$ NH|$DfL\$LT$Ht$LLT$L\$}LT$L\$LT$LLL\$݃L\$LT$H5{t$4LLT$L\$L\$LT$ DHLLT$L='L\$L\$LT$HHs= HD$HHT$PL\$eWE1E11PHLLT$ZYLT$L\$f.1OAE11L='HH5 1LT$H=v1L=&/,LT$E1H=K 1@H5膣H=* H51L=&eE1E1lLT$H5E&L\$H= 1;1L\$LT$L=d&5LH5"LT$L\$:DD$fD=D=@tH= L1E1H5#E1E1E1H= ED$H|$H H|$H7WH|$H%WH|$@;gLCkL;kLSRLAHD$HdH+%(D$HX[]A\A]A^A_@=E(H|$yHVH H|$@LHD$HH HD$(H HD$ gH|$@HRH5[ \>fH|$HVH' H|$@LHD$HOLE1E1E1?JE1D$_A*E1E1E1E1$H=IHc- H. H=g HHT H3CIH{HwIHH|$@tu11ҾL> HLnyHT$ H=F H5U1舛H=1 B論HD$@HH=E1YHH= H5sT15E1E11H= H5cT1E1 H= BLE1ֺH\$811LHZH|$8 Ht$ HLqZHD$8L$…1H =%~'HD$HL1Ho9\$8H %H|$(vH5L1E`H= H5S-4H= H5{SH= H5S1H= H5S1H bW H5 H=B6#jHt$LviD$H=B H5,S膙AWE1AVE1AUATE1UH-SHHnH+I@@DžtU(|wHcH>Aw&uAE111BD1DfH=y L1E1H5A11諘HSeH+BL#_HD[]A\A]A^A_ÐL= ,@L5 @HE1E11@E1@1ɺrLeHH,1ɺwLeHH"EZXIHC)IGHu0V 1H11MIHHuFH=M LLH5 \苗H=4 >111HG1IHubDIΉL$ qHIdH5QHHSLDaH5RHHSLHGmL$ IL$ EL$ 9|;E1A-LHE1qH=n LL1H5g[A褖H=M =9uHvHgw)ff.fH6H?AwHvHBf.AWAVAUE1ATUH@dH%(HD$81HHHIfAIL)$)D$HD$)D$ DIHI} tVIM(IUH=_ HH5Z1蘕Mu H54Luv}H=& H51hHDAUAHD$8dH+%(UH@D]A\A]A^A_fDH}72HtZHk$MHD$BH= LH5N1fH5N1Ҕ5DH},Ht"HP$MHD$HUHT$:nuZzouTDjA-uIHLLHT$CHtPHUH= 1AH5$H=H= H5Z1AHUH= H5{$1]dff.fHmb 1H=PC SH=@C > tHH0HHxuH 0蠏H5)H=m;LH HHH5\H HHt4H=B t*HB fHH0LH{H= uH[ÐH AWAVAUATUH-SHH8dH%(HD$(1%Iw9ADžt`At:AuHE1?HD$(dH+%(H8D[]A\A]A^A_H= LH51ARHc H HHHtV1HH8uuBH%LHL$HD$HD$ 3HT$HAPf1=H=bA 1H-QA HEw =9LH}8H0Hu޸OD$H=( L1E1H5K1L%@ [H=@ L-9ueDE4$A9H51L$ DL$ H= tnA΃IL$1LI0I|$teDH= AN|$u1H5L$ 輐A$L$ 9tP@AH5U1A茐H=5 H=) H51kfDH= AOH5U1A=}=~/!uAE11H|$ L-I+LTGL,LDGHl[H$8 dH+%(CHH D[]A\A]A^A_Í9z-5*DHc AH HH;FE#3EH|$AD$bH|$1ɺrg[HHHE1Ll$ f.LH\ LH\$06HHt$(HLLAVD$L PD$PDL$(|$,[H uAZLH5WH=߽ 1(+D$D$H D$ HD$(ufuzfxffDE_D$AD@E?H AHD$ LE1E11@9^fDfD$@D$1@ HS4HP HHZHT$ Ht$(LE1HLS AVD$PD$PDL$(|$,YH A}HH5苄IHL$ L$ LHhE WL% LH HD$ Ld$HDd$Ll$(D|$HIߋ\$ IHtTHL} EAVD$HLIPD$PXH uLd$A1LH5)PVLd$D|$H1AH+E1KZH ZH5 1H='H5QIHFH H5R 1H=y& ff.@ATUHdH%(HD$1H$HtCIHDLH$规HHItH4$HMTL%HD$dH+%(u H]A\YAUATSHtVIHH5QEL!juAD[A\A]L}AŅtA[A\DA]E1[A\DA]@H= LH5D1ȈfDAWAVAUATUSHH $HxfE1L-E1H&_dH%(H$h1H$p I)$` )$`DŽ$ DŽ$HDŽ$(HH$pHDŽ$ HHDŽ$P>LLH$E1H-]H$HzH D$HD$PHD$HD$ DŽ$DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$pHDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$D$(D$8HD$@D$`D$dD$XHDŽ$HDŽ$HD$HD$HHD$0HDŽ$HDŽ$HD$xHDŽ$HD$h+-tG..|/wHcDH>fDHٶ HD$@A,u12}HD$HT$PH= H511E1E1AH-qAH$\>H|$ LjRHB/H|$HNHL>H|$H>H$(H=H$ H=H$hdH+%(@HxD[]A\A]A^A_=~9HcH>ADD$=ufHD$AHA H$$@HD$0HH HDŽ$HHD$HfDD$`D$`Ha HD$0HD$Hf.L1E1E11E1H-?HD$DŽ$pD$dcD$XSAGA7A'AAH HD$pH5 H$&H5ɳ H$ H HD$H H$l@Hq H$T@HY HD$x?DŽ$(DŽ$ D$("$D$(D$8!D$8D$(fDADDŽ$ H= 1ҾM HD$ sDŽ$`DŽ$PDŽ$@HI H$,@H1 H$@H H$@H H$@H H$@Hѱ H$@H H$@H HD$hH|$H5} H|$?[fDHY H$<@HA H$$H|$0HtH$EH|$xtH= H"GH5rF1;H$tH=ٰ HCH5KF1H|$tH= H H5'F1D\$XE H$tH= H=H5E1H$tH=Y H\DH5E1H$tH=2 H?DH5E1mH$tH= H"DH5}E1FD$EM D$E D$E H$tH= H H5#E1~H|$tH= H H5D1~H$tH=f HH5D1~$G |$` |$`r $$ CvH= H8H5vD1?~H|$ptH= HH5RD1~L$86|$(? #\$(}$tH= HH5D1}EtxH-:H=> HV $ u DŽ$ $u DŽ$H$H9$ HL$pH2HHEHD$pHD$Ht1HPHD$H[H$EH$H$H$ H$(&L$ MED$dLl$0D$HY E HDŽ$PDHDŽ$HHDŽ$@ DD E1 H|$xH$(L6 HE1ɺHDŽ$`jjjjjjH$PH$`H@p1H5y4L$XM  1H$t+HL$H$1H$HL6RD$XIHD$L$LT$x$H$$H$9HHGH$HH5 H= HL$h?IHxHL$hHT$xHH2L+8LYLHD$h~cHHD$E1H= Hc0H5;1uH=a HH5;1u-D$dH$`tDH&0H`AH$` D$HIHD$0H= HH5f;1/uH=ӥ H9H5E;1uH= H9H5$;1tH= H9H5;1tH=p H531tH|$h1ɺrBIHH H5 H$HHH$Lo+H$HH|$HGt$dDD$P$L$111H$XH$XH< H$P11g1H$PH-P/Q=L Mt LHxH-/RHfHD$H, Hڣ Ht,HH|$HH54HHD$,H-fipHT$@sH= H5.HH H;ZH|$gHi+A}H$u11!g H$Lg E1H$DHH'H$H$HD$H$ HD$H5HD$(HsD$`Ll$8Lt$@D|$XL|$HHl$HHl$0H|$(#!9D$`H|$(t$`{LHxI?Pu}D$PHL5IM1I݉.L&LLL$MDHHL͙c L 9|H5 LLfD$`=H= ELH5711E1GqE1H-,_LpkT$PIƅOH=ʡ H5,1 q5H= HYH5"71pmH= H2H571pLH=n HSH561paH$&H=; 1H57}p&H$ D$XE11HD$@11H= H5+1-pIE HH@Hxc)H5611E1oE1D|$dH-+H$(H|$hH$PL*!*eH$PHT$hH5 7E1Mu:H$PDIHLH).Uu.AH$PIA9|GHD$hL)HD$x11HP111HTH$PDT HHT$hH56H= 111nHD$@H=x 11E1H551nHD$@XH=N 11E1H5M)H-!*nD|$dH=# HSH541^nbE11D$XH= H5*/nEE1H-)pH$[L$H$PH$0H$HH$8H$H11H$@`+H=i H5(IH=V H$@ H$@K=H$PHtHH= H5(11PmH$0HtfHcH$81HtfHcH=͝ HH5361 mH$` H$`W1H$` H(8H=n 11E1H5m'AH-;(lH=B E1AH-(1E1AH-'A}HD$@1H$` H$`VTH1-D|$XHD$@HD$@D|$XH$PHt1NFIHBH={ H5311kD|$XHD$@[1ATH1W-D|$XHD$@7H=- H53&11mkHD$@HT$pH5 H=6:HD$@D|$X1'LADžSH,AIc1&H= H5%H1jD|$XHD$@H=w H531jH=b H5331jR$1ɃLPDL$8D$=AZA[H= H5%A1VjH= H$H5c214jH5 H|$(Ll$8Lt$@D|$XHl$Hj_,p:H5 H|$(Ll$8Lt$@Hl$H@_H= H531AiH=n H$HHT$8H=ܖ ufDH=і L1E1H53AE1fH|$@L"bL2LrHD$HdH+%(HXD[]A\A]A^A_@1"H|$@AE1E1D$3 1a1T$<1ɾrL2IHtH5 H|$(}GH=֕ H5O/IHD$@1Mo|$<Ht$@11L0*IH= H5 1M7T$8H|$1ɾw?2IH'|$ ;H|$@ECD$|$8HLW\H|$@E1cfD$H HD$L5є @HT$HA9}sDHD=t$IątHL.&LL8z#.H=0H5fLHL,H5(LHeLd$HDl$1Ld$H5L>>H69}?H<=9 ItH LLeEuLLU Ld$H|$@E1L2ff.AWL=AVLE1AUE1ATUSH8HdH%(H$1D$THDŽ$HD$xHD$pD$PHD$hHD$`HD$XD$DD$@ID$D$HD$ HD$(HD$HD$8HD$0fDB|wHcH>HQ H$HHT$Ht8H$HT$HHcȉD$DH9tH5Ȑ H=Y31f.H= LH5p1AB`1E1E1E11HLT$H-LH|$H$RZL*\L H,H|$xHXH|$pHFH$dH+%(Y HĨD[]A\A]A^A_f.=)=A"@iZt^f1)  tH|$tH|$H$Ht$ H|$(HL$pHT$xYT$TH|$0rD1-,HH2t$TEDD$ E$1H1%IM~L1HD$H4t$PH|$8vLT$HID$P=LLLT$LLT$D$ADHY HD$8HA HD$0H=) 1ҾIDHT$PH=  jDHT$T֐LE1% D$@;H HD$ 'H HD$(D$fH=y QE111҉ƿ?6H$H$fDH=) dQŅH  H= L1H5[[\fDH HD$WH=ь Ht$XH|$X+fDH= Ht$`H|$`~fDH=q Ht$h_H|$hNfDHD$h@HD$`HD$XD$H$H$q=1HGLHH"Ld$xMbLLHXEIHL$xH|$0ML IHUHHD$I@LT$HIYt$PH|$8LT$PsLT$HIeD$D$PLT$=CH= H511OZDl$LT$ H= H51+ZH H=Ȋ LH5' ZH= 11E1H5wAE1YE1111HHH=l 11E1H56E1YDl$E1d111H[.1I+1E1E1?H= H51LT$ATYLT$|$@HD$pHL1E1PE11LLT$NY^LT$AH= H5,1E1AXH= LT$H=x H51E1AXH=Z E1hH$HaLD$hMtLL$`MtHD$XHbL$Dt$E1A1LT$+LT$IMHl$pHuHLD$LT$HL$HL=BLD$LT$HH,D$PLT$=H= H5T1WLT$L$1ɾHSL#DMpH1LE1PE11LE1LT$XZLT$*H= 1LT$1H5E1@WH= DLT$1LLE11sLT$H= 1E1E1H5AVH= E1HLE1VLT$LD$H$HLT$H|$"H|$LT$LD$H?LLE110LT$!&H= H51E1A3VE1L$Dt$1҉LT$ LT$ILT$11ARPT$TA[]ILT$HLE18LT$LLT$(H=g H551UH=R LT$^H=< 1LT$1H5wUH= {LT$,LLT$(LT$f.AWE1AVAUL-\ATLE1U1SHq,H(dH%(H$1HHDŽ$HDŽ$HDŽ$DŽ$DŽ$H׆ D$LHD$8ID$HD$ D$ D$D$D$$HD$HD$HD$(HD$@HD$0K|wHcH>H= H$uH= L1E1H5E1E1SH=x AL@L H$MHH-OLH$FH H$GH H$dH+%(!H(D[]A\A]A^A_*E1E1E15@D$1Dd$D$ t*D$ u $tH=Z H531RD$L$ L$ ]H|$H$pH$D$ u$H= H5J1#R fDD$D$$H HD$@H HD$0H=i 1ҾHuDHI HD$_H1 HD$(GH= H$jf.LE1E1E1/E1zL=Ɂ H5r LzDH H5* HHD$8MD$LD$HD$ sHт HD$_D$ KA=DD$+11Dd$AH|$tH= H51=PHt$H|$(H$H$D$$H$$H|$0L IIM$H|$@shIHHD$8L D$LE1 D$HD$ $=`D d$%T$LLO7sfH= H51+OXH|$0L I-I&H= E1E1E1H5= NH5LU5HT$8HH|$P1H5[H|$H$ HD$pMIoD$PoL$`L$H$H|$)$)$^LD$od$PHt$L#ol$`kHD$pHC yE1K\$D\$ H$H$EaAPE1E11PLLCAYAZD$ukE11LL^E1HLIHtdD$$LD$Htef8u5H5V L1`M11LLDD$CDžuD1qi1ɺrLIHH { H{ 1H9IHH|$1ɺwIHT$H)HLIM0LLD$LD$H5L1LD$JLD$D$EtR11LLLD$E1 LD$4fl@AE1E1E1E1Lv7LHVFLLH(D[]A\A]A^A_@H=z LH5z1IfDADD$H=Yz 1Ҿ HDH9z HD$L=!z @LE1E1E1WE1E1E1H=y H5\1E1A6IH=y :E1E1ALLLD$$4LD$eH=y H521LD$HH=y Dl$LD$H6y H=7y LIH=Py LD$Dl$LD$ILT$HHLMLL$=tY@tZ=u+fD=tI= u"LL7u;fD=u)@{MLD1DAWAVAH׺dAUIATUHSDHH$L $Ht$ L$HD$dH%(H$1uAjA ulE1H$'HcHLAă HHHuH$H4$L@E1AE1E1亜H5LfH$dH+%(HĨD[]A\A]A^A_f.|$ UNDE&f|$$FE1HcúH5 xHHD$?IHvAA ULΉHLL$]LL$9L $H=v H51FL $fDE1H$#HcHL$AăHHuL1LHHHD$LHLH(;E1AaH=v H51CEE1AH=u H51#EE1!H=u H51EE1E1H=u H5z1DE1LΉHL $L $9LD$L1LLL $L $AH|$M'H5uL=L $HHHD$LD$LLHLL $H(EL $A/fLD$H4$LLH$LL$LL$A]HT$HD$1H 8H5#t H=LLL$ZH MLH5s 1H=#~H )LH5s 1H=ZL $AWAVAUATUSHH $HL=iALH-sL-dH%(H$1Hs HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$HDŽ$HDŽ$H$D$hHD$HHD$HD$ D$lHDŽ$HD$PHD$8HD$`HD$D$XƄ$Ƅ$Ƅ$HD$@HD$pHD$HD$xHDŽ$HD$(HD$0ftG|wIcDL>fDHIr E1HD$8Wu1AHD$H-1HT$HH=r 1E1H5wqQAHD$@HD$8E1E1E1HD$H=q L\$HA&L\$HH|$@L\$H7H|$88.H|$^1wH|$( =L L]H|$SH$`H.aHLH$bH H|$HcHH|$ H|$ H|$0YH$dH+%(-HD[]A\A]A^A_D=~A 2HcTH>A fD=HD$@E1E1E1HD$E1H-dHD$8HD$]f.Hp HD$PwD$hcH=o D=HD$0HF[Ho H$,@Ho HD$ADD$XH=io 1ҾHD$(LE1E1E1E1E1HD$@HD$H-CHD$8HD$XfHn HD$xoHn H$T@AEDƄ$3Ƅ$#H=n 1D$l@H|$<H5mn H|$H=dn H5H|$ H5-n H|$ sfH$H=n of.H$fDHm HD$@?Hm HD$`'Hm HD$Hm HD$pfDfDƄ$@fD fDaH|$PDD$hH|$8D$hDD$lHT$HH50E$$$tuƄ$HD$@Ht1HHD$@H A#AAHD$AH-bH|$@H Et E@ $$$D$hH|$PD$hHD$@ƒˆ$t$XL-k H|$8_L|$8L) Ht$8H$LLHD$8H|$8L$hC @c 4 MH|$8B:;H|$`D$H|$8E1H|$`DALDD$(L R11I$IHLLILHpLLIH=j LH5H19LH$D L9u΀$7L$I@ H$H$H$H|$8oH5LE1T E1L$1ɺrLLIMt#H$uH$H=DNM#HD$E1E1E1HT$HH=_ H51H-.NH|$xwXGIHE1E1dH|$8Dž2H|$8H|$8DT$hE FAPE1ELH$PH$PjHT$(Ht$`+H E1ۅpH$$L$$L\$HLL/pL\$HH$HHD$LL\$HHIDH\L\$HqH|$H=^ H51E1R-E1HD$H|$8gH=] MŃH5e cL|$81LOH$HdHLTH|$5H|$wfEHD$HH=I] H51,kH5z|$h/D$lH$HcH$H$L$HD$HH5H$H$E1Hu\t$HLASL$L$H$H|$HL\$XYZYL\$HH=v\ H5jE1+E1H5mSI듃|$POHE1H$L$1HD$HLPjL$L$H|$H^_H$H$HH uH=[ LI1H5UE1*E1HD$H5LE1E1H=p[ L1E1@H5L*E1r|$PfE1L\$HH=0[ H5@hL$L\$H)H=Z 1E1H59*E1ALLL\$HL\$HPH=Z L\$H:AQEL jj$L$HT$(Ht$`H N$@HD$E1E1iaL\$HHT$pHD$H1E1H=!Z H5e)L\$H.H5COL$L\$Hff.fAWE1AVE1AUATE1UH-MSHHxH(dH%(HD$1HD$6D$ IDžt=|wHcH>DcADžuE1EHD$HHT$ E1E11DH|$E!HHH=X H1E1H5(H5OHof.AD̴Aj@HcW HW Lt$H-'HH3H&H='X H51i'fH= X LH5pW1AB'H|$(HD$dH+%(H(D[]A\A]A^A_fD$ +H=W 1A DHE1L@Ht$H=TW H|$11)H HHHH=W HD1Hd&H3HEt0HHHЀ vHvHvT@JHF w@HJЀ vu L0HH=V 1AH5<%H=vV H51%qH=\V H5(1A%QH_H=/V H51q%*H=V H5Y%ff.@AWAVAUL-GATLL%U1SH8dH%(HD$(1HD$ HH$IDADžABA|EGAwKcL>ffA'A~D覶ufE1E1fAhDXXH=T LH51&$fDH=T L1E1H5+TE1$H=T AH5L\H L\HD$(dH+%(5H8D[]A\A]A^A_fDH=9T 1ҾHDHT H$LE1E1E1Ojf.HcS HS LM MZ1LHH8uLT$:H5'LLL$YLL$E!E[LL$LT$1HMEeIE*IDAuAMAGAKFLLT$A T$LL$LL$HcT$HLT$AM Ht$ L*HT$ HHT$EtZHDHH9HHT$H=t6H=R H5P1!@1HD$諲CH<$1ɉھw!IH%LH5 SIHH|$tWHL$LH9HFHD$A\2tTDLL;D$HL$H)L$u~11Ҿ LfD1fDAT 1LH $H5, H $HA9HHD$E1:AT9LLT$T$LL$HLL$HcT$A(LT$HIH"LH9IH=P H5C1LLT$T$LL$QHLL$HcT$ALT$nLLT$T$LL$H_LL$HcT$ALT$4H5ʝLonH AH5O 1H=g)@AW7AVIAUIպHATAUHSH(HDL$ L 3R A)Ɖ|$OD$E11E1HD$xL-]HDŽ$HDŽ$HDŽ$HD$HD$hHD$HHD$PHD$XHD$8HD$(HD$@HD$`HD$ HD$0H=E ]H|$HCH|$H$ H|$`H|$@H|$(~H$0H$(H$wH|$PH|$XcH|$hH$LMt1IL5:EGILLLH$8 H|$0H|$ H$ 舶L0HxH|$pH|$8H$H$H5[H$fH|$xlLtH$mL_H$nLJH$dH+%('D$H[]A\A]A^A_D=u ~+=PH=C 1{E 2f=D)=@W@f./H$$\DHB H$H$蘸1ɽ\$5M H$(LL LH5A H=#E1D$fL- B M0H$LLH5A H=貙HL H=A 1E1H59AD$HD$1E1L-sHD$hHD$HHD$(HD$@HD$ HD$0bDŽ$ xDŽ$$`H)A H$(L@HA H$04@H@ H$@H@ H$@H|$xL-LH$LH$LmH$E11H$HH=m@ jjH$PL$CH H$HD$xH$H$H$H$EDH= @ 1$!H$fH$fH$fHDŽ$H$H$fDŽ$DŽ$H$ fH$oH1? H$T@HE1eD$]H> HD$ L-> =L褶HH$HpLt H|$` H5> H|$`fDL5i> @HY> HD$@HA> HD$gH)> HD$(OH=> 1$)f$$$1E$H= HD$HH= H$@L$0H> M L-]= MU H$ LL$5LHD$h1LHD$iHT$LT$hHL$ LHLHD$kH|$IMt*H|$8LtH$ LXHH=< H51 D$E1f.H= H|$P˼H=d< 11Lh?߸HD$PHL$0MxM(H$ Ht$PLLXIHH|$8H?H$ LwHH5; H|$p D$H=; 1ɺ1LrIHH|$XH|$XLfHI; H$l@H=1; H$tOH=; H$T/DŽ$XH: H$@H: H$@H: H$@DŽ$TDŽ$PHi: H$8@HQ: H$Ht@H9: H$@\@H!: H$D@H : H$,@H9 H$@H9 HD$L=9 @DŽ$DŽ$DŽ$DŽ$DDŽ$xH$=H$ H$H=E9 H5*1E1D$lHD$xE11E1HD$L-HDŽ$HDŽ$HD$hHD$HHD$PHD$XHD$(HD$@HD$`HD$ HD$0D$H$ HD$0HD$(HHL$L|HHHD1HL$1躴HD$hHH|$H11L(H$tH|$@t%H|$@11L*H$GH|$ tH|$ 1&HD$ HHE1L1HDŽ$p1jjjjjjH$PHL$`H|$PH@p1H5B8/H$hHD$(HdH$H$H$1IHHhqD]9 EH|$0L%A L[11rLc59 H57ILIHHc8 ~H1L袷H-gH>H1D8 EuT1H$hL5؃@;-8 1H޿0H8DV8 EtL1H L1l@Dl$EL-+7 MtHt$0L衢D$HD$L H$HD$0HH$w1$$Ht$0H=/@ HD$0HHD$E1HD$hHD$H1HD$(HD$@E1L-HD$ D$XHD$XH>E1HD$1E1L-oHD$hHD$HHD$(HD$@HD$ HD$0D$VLL$5LL$HH$ f.H!? H="4 H51d-H=4 H5y1J>@H$0IlkHD$`H)H$0IsH$HD$hE1D$E11E1HD$L-@HD$HHD$(HD$@HD$ AH=C3 HD$01LH5} H|$0t?$`H5 jH5= H "1k$EE$ L$L$D$$ D$r6H=o H5_1@ DŽ$ &LSH [vL10xLwL1LH vxH= 11E1H56L$`D$HD$L$hL$`E11H= H591D$jH=i u7H581H$H$71D$'H51rD$ LcH 1IH qIH RLH5z 1H=188ۏLIH 1vSL$`H=̪LL$`H=Lff.AWAVAUIATUH-# SHHhHT$L|$"dH%(HD$X1ғL# ILLLl$'IHt$ LL莓)HD$MLHL艌Iwc)LHsL)HL\H)LLH$HwJD%HD$/HH~E11H51LpHh1HT$XdH+%(LHh[]A\A]A^A_HLŋH蝒HwHl$譸HHt1HH胥LHHmMtTLHLiILLHS3LHL4HT$LHIH1LHѤLHLHT$LLLHLzL|$01LLC`DAv*fLHL$l9L$w؉LHKDEt2HL$H5"HDL$u1LH謜D$LLiD$=UUUUiD$m۶=$I$D$LLS1LL!>D$D$=`1LH#D$D$JLHGE1LHwDHT$LL3LHL(LHH|$@LL$N1HAHcȃHHIL 0JH$)I9uD$5DD$;H5qLL$LL$D$NIQMQDD$OA$OD_HHH?BBAHD$XdH+%(HhHH5X1[]A\A]HFHX~+BL%$LlLH1H\I9uHD$XdH+%(wHhHH5`1[]A\A](HFHX~BL%LlLH1HL9uDH~I}HSLHIH`PLDVH1LH5IL1H5_H~HD$XdH+%(Hh[]A\A]HFHT$XdH+%(uxHHHh1[H5֤]A\A]&fDHFHx0aH5qHIH1HD$XdH+%(uHhL[H5n]A\A]L7AWAVAUATUSHXt$HH|$(dH%(H$H1HD$hlH\$(H׋H5^D$Ht$0IA lH=ILd$hL-MMHD$PL|$PHuKDLpL纀LHIH|HLƞiH9HBHt$(LZIHuL誄H|$PD$H5D(D$XHHHD$H$HH|$PbD$<D$\D$H t$H|$P衹L<$LD$0HAHL$(Ht$IIL1g9D$XkHt$pLV$%=.LHHHH=wL5HH>t#IHHL9 I>HuH<$H5?~D$8IHO111L9LHHH-D$@H1膸H8HHD$ L$蘫LD$ 1LH5 II8 D$ Mt&D$HID$H t$8t${1AąufHcQ HR H HH *~ ?w]H;HHH;AHusVfDA$?Da/E15f.n vLE1EHD$dH+%(HD[]A\A]A^ÐH= L1E1H5;^H薩HHtoL5 :5LfD$IHtyH\$HHHHHt1HA,HHu=LL:jHHD$dH+%(uH[]A\A]A^ϣH= H5RAF7AWAVL5!AULE1ATUH-S1HdH%(H$1H~^HDŽ$HDŽ$HDŽ$D$|D$xD$tH dD$$ID$<D$8D$D$HD$HD$ HD$HD$(HD$0@x+|PwHcTH>fHT$xH= eufDH= L1E1H5A1E1L蒽LL2{HH-H$H$HH$H܉H$dH+%(A HD[]A\A]A^A_=D=@#^wfD1A|H|$H$mD$$El$Ht$H|$ H$H$iH5ԎH=. 1wE1A1E1@=FDfD D$t @D$$@H HD$(H HD$0D$$@Ha HD$ HI HD$oH=1 1ҾYIMDHT$|sfDLE1E11H|E1Hq HD$D$D$<D$D$8Ht$H|$ E1H$D$8H$ D$Ag9D$EtDT$Et$|$AH$H|$0ML kbHHH5.H״uH5^HĴt$xH|$(DIHsDL$Et$D$11HHE`詟`t$<L$DT$8E1H=sH5 1D$xJ==  H|HD$$$ D$eE11HT$H0HIվH$H1LHH$H5 1L誀L$MtLUxLLHGz|$x fH|$@HT$tH5x)$)$)$)$)$oL$@LoT$PHD$`H$)$H$)$k'LLE1kyH=H5AH=sOfD\$|AH|$0MDH$L HZH5J8 AA E1H1oIHHeLD$詸D$)uH=E1OrD|${DH$HH5HDŽ$ uLH5-1H$L,LH55I1H$辨H=rE1E1AqE1AnH|$(E1$H=-qD|$|$x S$ D$HPHD$|$H 6HeHEE1H=H52E1E1AHE11HT$HヌˌHIpHT$H=|1AH5eH\$xsHHtǃ@ wHLE1kf.$ D$H؋HD$H ;H:HDE1.H=H5\H=p.HHHD$H=H51AH5L1H=iH5b1H=ToD|$H=>H51Az|$Lt-FaE1|$Lt跓fyX۞JH=H5A Joff.@AWE1AVAAUL-ATLU1SHHxdH%(HD$h1D$\HD$`YD$0D$$ID$ D$D$HD$(HD$@HD$8HD$ ntg|wHcH>=!=~ʉCYu1AfwStmu1D$HrtaWtADT$HsEjH=YH5j1fH=)HT$\*Z"fH=L11H5|VAE1E1E1E11E1LDT$L%̡LL$fL|H|$DH|$躒Ho LLr~!LLb~"LHR~DT$HD$hdH+%(HxD[]A\A]A^A_D$ CD$$3H-$@H HD$(ADD$fDD$fDHHD$@HHD$8H=1ҾEOHD$L1qE1vfDAeDD$APD$FfDD$03D$&fDD$AD$fDD$Ht 1HDT$HBYDT$HHHDT$HAAH|$(11LaqDT$HHI]HDT$(гLItDT$(DT$(M2H|$81ɺrIHH|$@1ɺwHD$8LL$8HHLLL$HL5 LLcC$LcD$8LLD$@]LD$@LL$HHDT$(IpLLDT$@LL$((LL$(DT$@HI T$8LLDT$@LL$(Ld$`LL$(DT$@t$0HHD$(t3Ht$(HHt&LIT5L:0HH@x@rH9u11LDT$8LL$0jfLL$0DT$8HIdD$DT$0LLL$<<K<huLL$t$L˕LL$jLD$(HT$`LLLLL$Q^LL$DT$0;L$$HT$`D$ LL$LH߅]BlLL$E1FDAH=1E1E1H5E1E11RE1ALD$t$\H1H|$(L EvDT$HIXLD$t$\11H|$(L ~^vDT$HI-E1E1E11ARLL$~Et$L茔LL$~/LD$(HT$`LLLLL$覌LL$DT$0H=-H51LL$jH=ngLL$AE1E1E1ALL$E1ALHDT$LL$蚚LL$DT$H=fLL$E1H=1LL$E1H5r~¿LL$AsݮLL$DT$0t$LLL$DT$0TLL$LD$(HT$`LLLLL$gLL$DT$0KqLL$t$LLL$LD$(HT$`LLLLL$觎LL$DT$0&\AH FLH51H=;[DT$@LL$(H L1DT$@H5H=LL$(Y[DT$@LL$(Xf.AVAUIATEULSHDdH%(HD$1E-H 1LHIk9H=H讟IHH $ExDH9}QH=jDH51詽H5tLv1HT$dH+%(bH[]A\A]A^fHLHR~H5-Lu $H=1LH5ܘ,f uV1lH=IH5Mtm5H=LH5Ν1跼fH=YH51蛼1@H$H=UH5e1w2f=B=H=+H5,1M#HH=H5c1$1舌AWAVIAUMATIUHSHH(H=dH%(HD$1H:ZL5tOL藴HHtBHtju{H9t`I$LHEIE fE1L1HT$dH+%(;H([]A\A]A^A_MuH=ʼnI<$fHE뾐H=Ht$ߜIHtoH5L(oHD$HIHt%HT$LHVtHt$LܐuHH5L$s2HYH=:H51|LUtH5*LrfDH=H5қ-H5Lrff.@AT1UHSHaHIt+H3\M…!ЉC[1]A\fH=YH51蛹[1]A\@AWAVIAUEATIUSLH$Ht$t3DKLDLH|$L9XCH1[]A\A]A^A_DH=H51E1EtSEAwH=K,LUˆEE|E9v$EtH=H5藈DH=H57x@AUATUSL$HH $L9uHAfHdH%(H$x1DfL$rH|$tfHHfD$pLl$pkDdHHQ1rLCLHH=HN6uH$xdH+%(uHĈ[]A\A]:f.AWAVAUATUSH(L?H|$LHt$ cH5HHI诰HA?I1@~@|$M113|$I!fAI@t8I6@DF u赇xQ uIA$1IA?1@uɐuTLL)HL$L9HL$L)H([]A\A]A^A_LkH5,oH(1[]A\A]A^A_LwH5`oH(1[]A\A]A^A_1H LH5H=4SHuff.AWAVAUIATIUSHL7dH%(HD$1O HLD8HD=D;HHHHv"tEH$L9t<蟄 HDJ t*AmHuHDP u8I$ DHHT$dH+%(u"H[]A\A]A^A_fSHDP t躅f.AUIATUHH=Ht'H5?OmIHtyHLvsL讁Hvd=t]1A\A]H=H51˴H=LLlH=H5O1觴]1A\A]HAH=:H5s1|yAWAVIAUIATIUHHSHLD$_LI_HIDL9w=LLHuJ|=HSLtH[]A\A]A^A_f.HT$H=L1H56ӳH1[]A\A]A^A_fAWAVE1AUAATL%UHSHKHxdH%(H$h1HDŽ$HDŽ$HDŽ$HD$ DŽ$DŽ$|DŽ$xHDŽ$HDŽ$diDLHH$HMH@ED$HDŽ$IDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$pDŽ$DŽ$HDŽ$HDŽ$H$HDŽ$HDŽ$HD$XHD$PHDŽ$HD$HDŽ$HDŽ$HDŽ$HD$xHDŽ$HD$HHD$HD$8HD$0HD$(HD$`HD$hHD$@D#XtG3|4wHcH>DŽ$AWufD1]H=LH51H$AHD$ HD$XHD$PHD$E111HD$E1E1H=RWH=葍H=r腍H|$H+}LZHfL裝H|$(xH|$0xH|$8xH\$H5yHlHY\H|$`OH<$%H5hLH|$ إH`H|$`H|$LfH|$@fH|$hH$H;|$Pt.H5(hH$H;|$Xt0H5hH$hdH+%(HxD[]A\A]A^A_@DŽ$DŽ$D=!=OA!f <DHH$l@DŽ$XH|$@H5M1薎HD$@H0H=) 1譏$H=LH51U_HH$@HH$@HH$@HDŽ$H$fDŽ$hDŽ$XHYH$D@H5AHH$HyAnH= NHDŽ$D$D$pH5H$gHH=H5DDŽ$hDŽ$XDŽ$HDŽ$8r)H|$8: H5H|$8ck]fDH|$0" H5H|$03k-fDH|$( H5H|$(kfDHAH$f.HyHD$XgHaHD$POHIH$4@H1H$@HHD$xH=H$x>9fHHD$ DŽ$HHD$H=1ҾE5HD$`HoHUH=|H5DH=Q1Ҿ5HD$h3H$|H=)/>ifH$fDH=tBH$HHH=H5)@LE1E11WE11E1H$HD$ HD$XHD$PHD$HD$1fDD$D$pKHIH:x5DHH$@HH|$H$@xH$HIHDB u=H$QH$HH9H)H5H$ХIHH$LI9s$IHI9PDQ uI9H|$LL$aL$HfH=7I1LH52sH5YL`iE9\$fH|$xHt$XH|$PH$H$A D$pt#HD$ H=8t H5^1H|$ 1dHIHH|$HD$pa H|$H1}BH~IHHsHL$ H9 ItL:qHKIHwLCNH$H6 1HDH$ H$11E11AH讚H5HOiH$1HH=\H=tNH$11E11AHUH5~HhH=g1HH^\H$HD$P H$HD$X L%tH-UHLH1IHo vL踞ZH$H-L%ht;UHHLٝHHuH5qH艆cHDŽ$H|$HLD$h$xL P1H$uZHHH5sH=+65H<$tH=H51H$H$ H$$H$H.HD$ HPEE1H|$xtH=`H51袤H$H$H$LՆH9$HLDHDŽ$HE11j1jjjjjH$PH$H$qDH@p1H5\L$MH$H$L1QHD$HLH=^k$L$D L|$H$t A1틔$t?IHSHT$8LL:o(H=H5ޑ17$$t$ $ $AH$D$|HH$HǃwH$1D:pIH$$b.L$$HLvHLPD$pE$A$HmDt$pIM H5H}L~H5^L臈uH5}Lt LE1H$HDŽ$H5cK H$L]H$H5L}D$D $$|LL$~u?E1H=H547Dt$p DH|$L$ H$H$L$ H$H|$H1H5]1H$ӠH$[IH$E11E1HD$ 1AHD$XHD$PHD$HD$H5?H=(cHLH uHH[H5DiI7dH菐HD$HM H L|$H5zLzXH=H$H51ݟ$tH=wH51蹟H$tH=WH51號H$tH=7H5@1y$H|$x,EA腚HD$8H)mHD$0HUHD$(HH=H5C]HD$ H;vfCNH1LIHnH5}>LBWHHH>~H6kL=o+HT$ H51gH= H5d1MH=H513HDŽ$H$H5^H=i&mzL%lH-UMHfLHH$H m胃L=XE}H5/lH=-L%lH-mLH$HtzLH.H!HDŽ$H<$H$D$ 0< N:HEIHH)H5l_HHcH9Ld+HFHIH$1H5<LaUHH1H蛘IHHMDiH<$HH[H<$/H[wH豙H$H<$ HxH$MH4$L谂 Ht$`H-L"MILGlLHH$eRMLyH55 H1H$`H$H$@H58HH$ӅH$` HH$`LQm' H$H= H-!H=@c HLMtH$H' 1H|$(Hl$(u*4DHnuLHI`{HI9|H5LCD\$E L$p$LH4$HHLчH$D$p$|H$DIH(H-<L%hIHwHLNHH-j}nu}ou1}HE$H$D$1EHD$1H$HE1LE1$1HH$$b_AXK 6Dƒmu딋$HuL%>L-gH-9LDHLHLRH$H,i H=H5u1D|$pEiH=LH5}1טL=|H=Df~H=YH5|1蛘da~L%gH-nGHmuLH臐HD$XHJ dhHD$XH$ L%fH-$GHuLH=HD$PH@ hHD$PH$$HuHo3H$H=H5|HD1H$1L%BfH-GHtLH謏H$H/gHjDT$pEH=1H5tJH$H=H5t1&H$WH$H$HD$ HT$8$H tH|$x耮IH"1E1E1AHD$HD$fPAE11E1HD$ HD$HD$Ht$`H H<$p}DžA Ht$`ܔI?HRH$E1H$H<$1H5qْH$A$0<  1LE1wHTHRL$$1H$H=lH5x1L$誕H<$H5pN[{H$E1HD$ H=LH5r1UHD$ E111HD$E1EHD$ E1HD$1E1AHD$TH${$D HHD$HDŽ$MM $$3L$E1L1A1L7H5`LVH$HtH=DLHLQH=HtLHKrLPjHL$0H$HLp_]H$MHD$KH=I1H5v˓yH|$H=YH5{1蛓H=?LH5AzH$HD$ H= H5xQ[yLH$E11HD$ E11E1HD$XAHD$PHD$HD$HT$DxHDŽ$RHD$ HD$HD$H=[H5p1蝒H=FH$H5p1耒E1H$LtH$bH=H5D{1A:HD$1E1E1HD$H=H5pnL|$1E1E1ABE1E1CH5pLm+|$pueHt$ Ls-H=Y11E1H5AE1荑H=11E1E1H5mD$'H5a11PL^Ht$ LrtLo^D$E1E1L}IHD$E1H5L*#H5MLPCuH5kL=CsH$H=V@1H5`w蓐LH-VMHLBuuH5kLBubH-1LHBuLH$H5qmH=/lLg}HD$ E111HD$E1E1H$H=1H5fv4}m7sH=qH5Jx1賏H=WH5p}蛏H$M1E1AE1HD$$D$A!t)Ht!$|HL et E1E1$D$pt-$ D$pH\HH5HLK$Q$L{Dt$pIH=iH5 1諎LEHD$ E111HD$E1E1HD$=H='H5u1\9H=H5QtDLDH$H9HH5PHcH9HFHH:|H$H=E11H5sE11ݍH$HD$ HD$HD$|11ҾH0H111&HHHD$ }H|$ Is>HZMH= L1E1H511E1@H$HD$ HD$HD$H=LH5r1E1H$HD$ HYxLWH$HCL-CH=fH5ihHH4$H=_IHD$ E11E1HD$HD$%L5H=H5i1A9H-ILH>taH$HDqH=H5'rgH^H=_L/IqH5fL6>uDLuxH|$H$H|$'YL$IHD$ H{H|$HD$pAH|$D tH=H5v1A7H5H=)HHHD$@H4HHpLH8$H$tH=tH5v1越$AHH$H$葸gHt$pHlRH$HAHHH?.$H|$xtH=H5Bv1#EL$E11HHt$AL}H5LXLH$HtH=HHL?/H=HtHHgL?$tE11ҹH'mu;LD$0MLHH$$St*H$MHD$H=H5av1"H$MAE1E1HD$XL9VIIL+VxDŽ$ Hk1HJLHDH=PH5u蔈mH$H=0H5IutML$E11HLAH|LLs]7LHBAmE#H=øH5t1 H=H5tL UH|$ IHD$ IE1HD$pH5-H=.+IHH-L%'V6HceHLHHwWH5HHhAL%UH-46HeLHMH$HR'WH$H=胃H$HL%UH-O6H LH~H$ HVH$ H=#H$Hty1L|)t0HD$ H{HLgtHLpH=11E1H5qA8H$HD$LE1ItH$ H=H5dkHDŽ$TH$H=H5cυrkHDŽ$kE1UH$1E1AHD$LRrIHt+HL?y$D$pLRHOH=H5c1:D$E1AvwIH5cH=1LLPD$ptK${$:H=pH5sE1豄Dt$pnB{ZH5fs_jH5 SH=qH!bUHHoGH= H5q1OH=H5 m1E1A,L|$E1vH$H=H5qdLE.QE1IPHDI݉H$29H$"^HpHt4HtH@:wIsHE1>+u H1HJRAAP$HQEY^[izP=H$(H$2DŽ$0L$D$4H$H$L$$0D$0L1DA9L!]L`HL.IHvgMtH5`LuctH5`LbctIqK|,H5 CcfK|,H5"*cMLHP:w@H,HHHHL4P$D$L$1,L/\ADLHHHplHL09|HLk!xLEDŽ$A<$+uDŽ$IL(vADžXHUL$LldH LL-r0LHLyIHPHULdLH !TL5 0LHLxIHPHULȸdLH ^0H=SH$8/H$8LHH$ +"eHDŽ$HULYdLH #^H=H$8W/H$8LHH$*eHDŽ$H]H}LLL$`PH]PD$Mዌ$KA[]vMAP$ ALADP$H$8UAYAZUL$H$8&O^OdldL-E LHL9iyLkH|$H$H|$KLL$IH=DH5g~+H=,H5i1n~H=H5g1T~H=H5h1?~H=H5h1*~H=ӮH5Th1~H=H5h1~H=H5h1}H=H5[1}H$(L$H$D$40 $H$H,~ =QD$xD$H\$H$ H$D$xDt$xH8,DA9HWLhH$LqAƅtL$L<LdH Ls.H-ĸ?,LHHtHH.LLLdLH "H=sH$+H$LHtH$H]LLLdLH JZzH=H$+H$LHH$&aHDŽ$LLdLH YQ L-+H$LHLg&ZaHDŽ$H$L$`HMHxHYPHYPD$$H$HG^_v|$LDLAjH=H5XYH\$zIH=H5e1zH=xH5e1zF[H\$KH\$D$\`:R`H-JwJfHHHA1ff.ffAU1ATUHFSHdH%(HD$1ILm#H58iHHUH<$tlLHc1JIHtoH5 sHU1LH$H54sHUL|[HT$dH+%(uMH[]A\A]@H5hHiUfH5hHQUH4$HS1IDATUSwNH HHcH>AH=H5h1xH}D1fH=H5h1xH=m[]A\fDH5^hHI6LtLH5Ch#LA1EsH?1FVtE,@H=H5q1;xH=H5r1&xH=ϨH5Hr1xH=H5[r1wH=H5hg1wH=H5Yr1wH={1H5rrwH}$AH=UH5vr1wH=@H51w[]A\H=H5f1[w[]A\@H=H5f1;wH}:H}H}PoI[]A\fH=1H5fvH}r -H}W&=t H=yH5r1vfDH=YH5q1vH=DH5q1vH=/H5q1qvH=H5r1\vAWAVAUATIUHHSHXdH%(HD$H1%LD$HD$ )LHn+LVH5eH1uL5&IHzDLI4LH5[fHH1L5GfuLy6H5JfHH1uHD$@H$LHa4Li!LIVHo1IMt LeHH5 fH13uHD1Mt L_eHH5 fH1 uL'11ҾIHH~H=H5e1tLQ11ҾLHH~H=cH5q1t=ްLl$L1HHA9 LH.M1H5-aHq=.tL-L%;L1HH LHLLH5^H1m{H $11L'HD$@+ H5IHxH|$@fHT$@1LHHD$RLT$MLT$L+(fHL$HT$HIH5yi1ZmLT$Ld$(L5]H1L7mLmIHH5H]H1mD kEoDLeHD$H5^H1l"fLIHHH5\1l1ɺLHyg@HD$@H$H5hH1E1clfDH5]HIl3@H5]H1/lf.H5]H1lf.H5hH1kf.H5ahH1kf.LHVLQHHHHH5[D$1}k|$H|$ GCLHHD$1UkL$Ll$ Ll$Ld$Lt$(EA@DHEHIzcH5[HH1k1LHLF:E9~H5[H1jAD9t$uH1Ll$ Ld$H5Lt$(jLMH*LIGHrfLH5pgHH1{jLHL H59ZHQjLIH8LHC)HH5ZHH1jL*H5ZHH1jH5HZH1if- H5ELL"1H5,ZH1iH5{YH1H :H [LH5ؙ1H=ZBDAWAVL58EAUATIUSH8dH%(H$(1HDŽ$HDŽ$_H$LH$HH$(1H$HH$`HDŽ$H$HH=}HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$HDŽ$DŽ$HDŽ$HDŽ$HDŽ$ zdH$FHH$THHHD$0Hl H$] L-T@L`HD$hHjL@`HD$PH&L@`HD$8H&H|$0E1H:t;LHhfHD$XAHzH-uHD$xDŽ$(DŽ$DŽ$|DŽ$0DŽ$xDŽ$DŽ$tHDŽ$DŽ$DŽ$HDŽ$HDŽ$hHDŽ$DŽ$pDŽ$dDŽ$DŽ$DŽ$DŽ$Ƅ$,DŽ$ DŽ$8DŽ$<DŽ$@DŽ$D$DŽ$f~D$@f~$DŽ$HDŽ$HDŽ$XDŽ$`HDŽ$PHDŽ$DŽ$hHDŽ$HDŽ$DŽ$H$HDŽ$HDŽ$HHDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$`DŽ$dDŽ$DŽ$LDŽ$DŽ$HDŽ$DŽ$DŽ$DŽ$ HDŽ$HD$HDŽ$PHDŽ$HDŽ$HDŽ$HDŽ$ HD$ HDŽ$@HDŽ$(HDŽ$HDŽ$xHDŽ$HD$HD$(HDŽ$pHDŽ$XHDŽ$HDŽ$8HDŽ$0DŽ$HD$`HDŽ$HD$p DžAEu  3t$8tGʃvG˃tGƃAGH=H5`1bHD$(AHD$ H$HD$@HD$1E1E1HD$HD$H=/ [H= LL~11EH|$;H5H|$WH|$H$H|$  LH$ LlH|$@ LZH<$H|$X L?H|$x L-H$ LH$ LH$ LH$ L LL LHH$ H$H|$p)H|$`)H|$0VH|$h L@UH|$P L@UH|$8 L@TH\$(HtH _H,HHTH$\H=O*-H$H7-H$(dH+%(ncH8D[]A\A]A^A_fDAL$t>e GfHcH>  ~6HcDH>D@@dXH$CfD/)H$\$#\]GH]H5n\fDGED$DH|$pLl$pH5xLtH5=LMHޚH5Zf.H=11E1HH5AE1F^H$HD$(HD$XHD$xHD$ HDŽ$HD$@HDŽ$HD$8HD$PHD$hHD$HD$`HD$pHD$HD$6DŽ$0\DŽ$LHcHHH(HF1HH8u.H|$XHH=H5\1.]HH5AH=ɍ1]KH^H5ZH=H5Z1\H$HD$(HD$ HD$@'HYH$lHEH$XH1HD$(GH|$`H5H|$`Z"DHH$DŽ$DŽ$DŽ$|DŽ$xHH$pHH$XDŽ$ }DŽ$tmDŽ$]DŽ$MDŽ$=DŽ$-DŽ$**DŽ$`H=͋H$fDDŽ$LH= 1<=a==$Ƅ$,oH=H 1;)QH*HӖ>,DŽ$$DŽ$HDŽ$H݊H$ޕ`)DŽ$DŽ$DŽ$dHH$HqH$xH]HD$ sH$H=DJR_DH=! 1:H$(DŽ$DŽ$3fDŽ$H$DŽ$DŽ$DŽ$f~D$@f~$foiDŽ$H$DŽ$DŽ$DŽ$f~D$@f~$bfo5iDŽ$H$DŽ$DŽ$DŽ$f~D$@f~$ HDŽ$H$DŽ$DŽ$fohDŽ$DŽ$DŽ$DŽ$f~D$@f~$foJhDŽ$DŽ$DŽ$DŽ$f~D$@f~$JfogDŽ$DŽ$DŽ$DŽ$f~D$@f~$fogDŽ$DŽ$DŽ$DŽ$f~D$@f~$HH$fo.gDŽ$DŽ$DŽ$DŽ$f~D$@f~$^fot$@fo gDŽ$(f8=f~t$@f~$,fol$@fofDŽ$`f8=f~l$@f~$H=ӆ 1W7H=ІH5T$,1 Vfod$@foff8=f~d$@f~$fo\$@fodfHmf8=H$Pf~\$@f~$lfoT$@fo.fH7f8=H$f~T$@f~$6HH$"HHD*H$E$H$HHBDi@DhHEuDHH#DŽ$DŽ$+DŽ$vDŽ$fH?D$(L-H=FI@I}IHLW5uAED$($( LLL$D$L$E11D$D$hA ID9E9t C<(,AUuH 1L$hI<4IIcAfDD`AdAEL$hH5H$HDŽ$8H=H$H=H5h H$HHʃH=ӃH5ESH$HD$(HD$ HD$@1E1HD$E1AHD$HD$PfDDŽ$pDŽ$p`DŽ$dP^ADŽ$1DŽ$!H=1ҾH$HHH=H5P*RDDŽ$H=YSE1H$HD$(HD$ HD$@@HrH{H$HRH$PeH>HD$TH-HD$CH=t/f.H= 1}2D-DŽ$`u EH=ӁH5u1QL%H$'Lt HDŽ$M L*LAMDŽ$H$qL-JH|$x'L HD$xMF*LLFMHD$x,$ E1DŽ$ $ E1䉼$HӀH$HH$hH= 1/1$H= 11$8H=m 10$<uH=N 10$@VL-/'LE1H$HDŽ$M"*LL"LH$L-'LE1H$HDŽ$M*LLKH$L%H|$X'L[M L*LE1KHD$XuHNH$XaDŽ$QH*H$8=HH$ )HH$DŽ$ H~H$0H~H$H~H$DŽ$H~H$H~~H$Hj~H$(}HV~H$@iDŽ$YH2~H$IDŽ$9'L1*LH*JHD$X@$1D$$ $K D$EtH<$ H$ $uH$ H|$XHtsH$H$1L$H$GL9$t_LLH9$taLHHLjH5 L@H$Xl L$H$M H H<$. D$E uLLHH$HxNHD$@H$}LHH$~LIHHM'NHNH$XH$H$1FAL9$tLLH9$tLHEH|$xHt4H$H$1FHH={H5Kg$u$$H$HHH=oHD$HHHD$ Ht1HHD$ H{H|$(t)H|$(1HD$(H> H$p H$dL$HL$ L K1ҋ$H$>HD$HgH|$t0HL$ $L =H|$H4HD$H$xt+HL$ H$x1H$L< KH|$tN$H|$H 1@HHKDHD$H:KH|$HD%KH$?JH=#JL$H$P11L IH$H5nyH=oy:IHI1ɺNH:$LHt$pH|$0LH$HtHL5J$u$xt1ɺ!L $O$N$0 O$|O$L$L$@M$<VM$8M$~ HcL#?$,tL:5 NAQ$LPt$$XH$@L$HL$H$0H$8H=xH H5I?LH$t4sBHH-LH$HLHL$&H$HHt HL? LH$HCH=I=IH5ULH$IH$H5b*HH!G111H`HH&H=IH5HD$pH@HH=:tH5B1|CIƄ$,*>HD$`HHH=sH5MB16CHH=sH5dB1CH=sH5B1BHD$@LHD$@1E1H~HH5BH=]s1BHD$(AE1HD$ H$HD$HD$HD$H= sH5B1NBH~H=rH57B10B$DDŽ$$H=rH5BAH$HD$(H|$u[HD$H=wrH5BAHD$(HD$ H$E1AHD$HD$ L$HL$ 1L B$H|$zHD$HDH=qH5dB15AH$9H=qH541AH$H=qH541@H$AhH=qH541@H -3@H5qH=-=H 3@H5pH= d$C$t1L!CH$CH$Lu$C$`HALyU$ LPL$D$H$@$H$HZY@$Ht$LD$HT$LH$Ht$$FH$H$`L$0-,{uLJ4BH$0D$H$0LhDx[H5L|H$0Lp)D uH$0xuH5L H$tL"0F1ɺ,LH5aLIH$hL$L HHu$txB$&B=zH$PHtmH5HH111H$H$I MLH1H=nH51OLc6$A$oH<$H$H$H .H|$`HyH5ALH|$`Q1H$$H$0H$9$\H|$`AH{ E1H$0HH$H$SIHHH3Hu xHDx5xLxL<$)H=xL$$!DC$H5LH1H=mH5@A?=A3AAAAA<_<DRA <H<H$H|$`HttH5-=|H=h1A7H$H?tH5P;H=h1A7H=uhH$|H*H$H $1Ҿ7HHTH=5hH5n;1w7H= hAuH$!H$PH5Q+dH$,#HHAD1ɉډAăL0LDH=6$`0H#20$0H}DDHO/$D$L$ m0HAHiH$H-H+HHt,H=fH1H5*06H5o*HH$H/H$I $1H=qH5e*5$ $$?*$)1$$0.EIM-T H$H-L$$1L+-H$1Ҿ LH$>$HDŽ$y,H$11H.yLbH9-L%1ɾxLH$5H1$t*H $dL|1ɺLh$$1=Kp@1$t;-H5LzH$HHQ-1ҾL$d'$pE'LLLMLL,9~|}$`H$Xt>5pE1L5fdLD$8H$H$H$ZYy#$( NHBHcH>L+$`|H#IHb LHH-)1BL$Ll$8@LL5~ A}"^ 11Ҿ LL$LD!L|uH=qcH5 :12H5'L12Ht$8@L$UHc$H\$8H~H\$PHt$8HHOH5HH$t>LfHtLYHH=mHt $L$0AHDŽ$@@HDŽ$H$HD$hHDŽ$PH$8$DŽ$\DŽ$xDŽ$ DŽ$,DŽ$hDŽ$<HDŽ$$X1L$IH$1 H$ 󫋄$ $HDŽ$@L$PU$8DŽ$P#$ $P$Dt)Hc{IHJ $,`$$ 7L\(LR(Hc*IHJ $u$t=$xL (L(HcIHJ `L$@$`1H$H$_ H$@L1.$L'Hc`LHH$0h'H$0H|]Ht$PL@LƉ wH >HcH>HcIHJ `rH=jH5&1.L JD 艄$,uFDŽ$ E1DŽ$xJH=5j1H5%W.D 艄$,t$ DŽ$,H$LL$L$H$H$$H=^D8!H5v% $8t$HH=iHqHyH% $HDŽ$HDŽ$ HH$H$HcȃH$H$$Ht$PH$@V~RH$1 H$$L$1H$$H$H 1H%DH5o$1,H=hH5*$1, H5#H=^h1E1,H$H=]LL$L$H$H$D$KU$ DŽ$,$h$<H$H=gH5#LL$L$E1H$1H$+$tSMu$xHt$hLDH$L(LƉ H 4;HcH>L#HcdLH`t#HrHcAH`HHkL9#HcLH!#HH$Lt]H$LE1L$L$H$H$H=jf1E1H5!*LEHczHH$HH|$h@A$E!EEH$HMc L;$@L$HE1HDŽ$PNuHcH``HH=WHc$hH\$PHc$<Hމ;)$<$<$hO$ $ O$,$,E1H$LL$L$H$H$H=YH51E1(H$H=dH5aLL$L$E1H$1H$(hDŽ$H|$h 01A1HL$h< uHA9AD$H|$hH)D4HcD7A uAHc HyM1A|Mu$t jUH$H=rXLH5L$L$H$1H$D$'H$H=EcH5LL$L$E1H$1H$A'[1AE1H=bH5M1'H5EJqH=bH511&DŽ$ DŽ$,XHcH$I)ׅ~rAMDDED.LHcLH`H$0HH$0DH=WH5[1U&*LL$L$H$D$H$LL$L$H$H$D$H=VH51%H=}VH51LL$L$H$D$%`LB HL/DA}"UpHIHxLHaH\$8@LH\H5L1%11Ҿ LHL@*H5HH\$8HP11Ҿ LL4LlH=eUH5+1$H5L1$Ht$8@L$IHc$H|$8H5#XH&HT$8H=TLH5L$L$L$H$D$ $&H53L11Ҿ LH\$P@LH;SL$LL$AL$H$1H-pLL$AILHl$8I}.t8@HLLH$>HDEჼ$L11Ҿ HIDIL$LkLD*HT$8H=S1LH5L$L$L$H$D$"HT$8H=@S1LH5L$L$L$H$D$W"qH$H5HHfL$Ht$hL@H%H$H$LHt$h& 1LH=RH5w1L$L$H$H$LD$L$!H$1H=*RHt$8@L~H5LL1M!Ht$P@L[$H=QH51LL$L$H$D$  HH=uQ1LH5KL$L$L$H$D$ $0L$H$PH$8L$HHMTD$XAA$\$0L$L)$HH$HDŽ$PMHDŽ$E1HDŽ$'$$HH=[L]$($duD$8DŽ$(DŽ$8$PDŽ$HAH=[H5[)1$d4LLLLEDŽ$8DŽ$H%$Ht$8H=O>H=OH5LB2BD;H=`OH1H5($0L$HDŽ$PHDŽ$HHDŽ$AE1B?HJ,?I{I)H9k{{ }HHHYE:HuIHtIHH5HL$0AŅLH=H5AHNAH$0LD]H$8HH$PH$HH)HHH)H$PH$HH9u HHH$E1H$L$L$H$H$H=MH5 1E1H=~MLH5d'0A H=TMHH5'1HXD$L$ A$A0D1HHtc HLL$L$H$D$H=AH51JH$H=6D$H$ L$H$L$۬nIH$LD$LL$L$L$H$CH=,6H51n2IL$LH$LL$D$;H=5H5<1&MH$L$H$LD$LL$H$H$H~bH=z5H51MH$L$H$LD$LL$1H$t8H=5H5F1ZH=41LH5L$L$L$H$D$H=41LH5AL$L$L$H$D$H=t41LH5$L$L$L$H$D$zL$LL$L$H$D$JaHHHLUILH5tH5>L迮H=3H5L$LL$L$H$D$H$oH=c31H5L$L$H$LL$L*D$HIH-LHiH\$8{-u@HL\H$uH]H$$( H$ H5L1L1H-11Ҿ 謤L$MIH\$8{-u7@HLLH߉$荢HE郼$M11Ҿ LL$H=/H52AE1H$鐜=:t =:t`H:H=:H=~/H51E1AH$4H$AE1迳H$HH:tH$uQH$HmH=.H5uE1A4H$鱛H=.H5ZAE1 H=.H藫H$tH$E1AHD$UH$AE1HD$6H$H=M.H5LH9H5/xʺH9H= .H5x1bHD$(HD$ NH=-H516鋺H=8H51[H$jH=8颶H=8I$HH 4@H5-H=>E虙H$H5R$LAгH5pL]H=!-|H$D$LH=,H5(A1H$鮙H5X HH=,H5H$D$驿Hv1ɺ!H*L9t-t=.fAT3.WA|3-K-B1ɿHHH1H?ƒ!Ѕ 1ɺ!L'H$L誮H=+H5uH5өHKH5jH=+1H=+H5sAH=i+ġH$HH$$H51뭋$<1ɾ}LH$<H6H55AH=+KH$ȗ$@1ɾ4L蘿H*$@Hi6H5AH=*H$u$81ɾ~LEH$8H6H5AH=Z*H$"H5H=:*H5AvH$Hc$1ɾ|L¾HSHc$1ɾ{L蝾H۰.LBL0ΰH=)H@5L1H=)H5Ht)L5H>H$H1Ҿ6LH$H4H5+H4H5+WH=)jH4L1H=(H5;iH΢9$pH5`H=&)DD$L$ LL$L$H$H9$V1L$ATD$D$$Ht$H$ 萭_AXH=(LL$L$H$^vH='LL$L$H$2żH5L1 !AWAVIAUAATIUHH=2dH%(HD$1H$mHŽ=M 2L=LLtH==2H=IHH$IcH9|ULL:H5dL趮P2($HT$dH+%(H]A\A]A^A_H=&HH5WD1H5LQ1DL0H=1H5L1L=LLt`H=1LL1H5ruHA1A,H=a1H5!={J1H=31H51 H$H= 1H5$1fH=%H5150uYH=j%11Ҿ 茗H=011Ҿ w1kHQ0H=2%H51t1HDH=%H51Sff.AWAVAUIATIUHSHHL5kdH%(HD$1LsL9uFHLLПAąu1H=/Ht]HAąt&H/AHHAHD$dH+%(=HD[]A\A]A^A_DH=A/HAIHH5H膧IHeIHtH$LH~u*LH5A薫L^fLLtHiLotH5LAAL3fHq.H=R#H51H=1#H51sH5LߪDAW1AVAUATUHSHH|$_HH}IH}H51I\$E<$EtNL-[fELAǀuAH5HDP@IDH}D1HD{EuH}H5~1HuHtPL(AąuiH=-tWH}H51eH5f-H|$脷fH}u)fAHD[]A\A]A^A_E1DefAWAVAUATIUSHHxVmH~H5 H=`|HX1H|$$EADH\$@1HHH=ZH=AKHcDLcl$ILHJ D@HHL$H L@ћE1|$11H薜H講H=СHc舿H=H\@跡LHH!bHL$H#L@D$HD ^E@LԠË  ZuDUAHAktDHqk  H HcH>D'LvfDHHNC8v1Ҿ9HH n|fLD$01ҾIHLLD$D|HLD$ H=H5~1AH=11Ҿ puH=9yH=H51cH=t11Ҿ .uE~ IcHD$D)DD$EH=1H51AH=11Ҿ tH= H51H= 11Ҿ tH&cL%(H= H51H= LH@jHƉsitHdi IcL>Ll$01L!HD$0LHD$8sL1Ҿ#HD$0LHD$8sfDH5H@H=qw+ƒ߀KuAW   , }}H= H5q1buH5HIԜAuٺH5/HHH脐9&xH5>H虜LH~H5_H1}L腨HHjoD$1HĚIHLAHD$FHL$H5sHH1DD;t$tUDHArHHD$襎H|$HD$~HL$H5#HH1ͿAuD;t$ H5>H譛@LL-HH&H5H1E1}D$u2fHHACH<:uغH5HD)D$D$HH5a=i=UUUUHfFHGE1軎fH5Hњ@H5H蹚@H5<H衚LHt$pH|$5Hq@F@ HQ@:@.t@/@\ qHQ@@ Z@:P@/@\@@AHQ<: < 5E1H=qdAD$D0@#m=`0DHt$8L$%D#H|$(H5,H|$(JjtH5H|$(5jHT$hH=H5R1##H=H51 HT$hH=H51f.1Vt;|$HH$ uD=E|$\H55$${|$X$DQEtD$H55E#$D\ZEn$=CDŽ$Ht$H|$ H$H$BH=`H5=HD$H$(HHD$HD$H$HHD$H$b[_$=HD$1HD$HD$ H$t)H$H$XpH$PHHNH$0HDŽ$@t)H$0H$H~pH$@HHH|$tN$H|$H d1XZHHǣHD$H&H|$H\g{&MH$pLD$0L H$$HID1HG]HHH$L$L*(UIHH$hHt 11H$L$'bH=H&H$1$H=HT$@HEH5HD$H$H$SHHH1ɺNl|$x%HHt$(L`hH$(HtH=sH3$u"$LtH=E1ɺ!D$xtD$xgDŽ$@WH9j{DŽ$DŽ$HHjHH$8LLAL$҈$iL$$HLDQ PHuoHaH$THML$HH$9MD$H.H'L$HH$9MD$HDŽ$qHH$(H= 1%{$H= 1{$jH=c 1z$KH=D 1z$,D$PD$HD$PD$HD$PD$HD$PD$HD$PD$HXD$\HD$@wXD$PHD$@D$HD$\PXD$PHD$@D$HD$\^DŽ$N?H=8 1yH HHlHH$pDŽ$HH$HH$HH$HH$0{lHeH$XLDŽ$P<DŽ$H,DŽ$ DŽ$DŽ$DŽ$DHH?H= 1GxgHH$XH= 1xD$pyH5 DH=a 1w$TFH5f.L$p@ED$pDŽ$LTHH$DŽ$HH$xHH$DŽ$DŽ$H=|H$z)bDdId:DŽ$*H#H$DŽ$HH$HH$HH$DŽ$HH$HH$H=/j[L=.D$`!dD$` H= 1uD$`YdHHndHHcdHH;dE11jH=L@HHjHp PRH PD$`xHqD$`Hc]DŽ$MH$LLH=1LTH$HH$LKD$XHDŽ$H= 1bt$HH$HH$H$H=&}L-idH$HSHD$IHBH$p5H.H$h!H$HHD$H$cHHD$ HHD$HH$`q|$XyD$X|$XD$X L$X1LH$ED$X?JH$LHDŽ$JH=7H$H$HDŽ$ H=H$H51LLH=t,H= 1=rDŽ$<`‹H=H51אrHkH$ ^HWH$JH=C 1qDŽ$_‹~H=H561aH=}1E1;=HD$SWH=HD$0L$X1LH$ED$XwHH$LHDŽ$VHH=o1H$HDŽ$GH=PH$H51芏DDŽ$DŽ$[CfDH=LH51 -9|$\_$H5Ͳ$|$\ƒЈ$tH5DE|$\H5{;H$LFH$LHDŽ$FD$XHDŽ$H$LFH$LHDŽ$FD$X HDŽ$|$\|$X$H5pkHD$(H=fH5Tf.|$\H5MeD$\FH=H5ӣ1L=PXfH=ѽH5R_LD$0H$1L $H|$BHD$ HH$$LH$9HD$H H$t(H$11H$ LF H$p1HD$H*LD$0H$L T1ҋ$H$NAHD$H H$$L2H$(9HH: HH5HcT$HH=41ɾ{0QHA/HD$E1AH=>H51E1AH5.H=ZH=AX2H$(H=H5A"H=˻&2H=rH5 H=H5A؊V>[WH$@PD$DD$lL$hH$@AXAY |$XH$8 MD9D$\ $H$8tv9$j H$84H$8D$@DH$8D$PpvH$8D$`!H$8HD$p?|$PHu$!DD$HD$H|$@ uL$HHtH$C9D$PH$y T$`t$P1ɋ|$@;D$@|$@9 T$HHt$p|$@)k~ $ H|$p\H$8D$H`D$H1ҋt$@H|$xHDŽ$8f1HD$@H\$HHl$`$XLl$PLt$pD|$x9tH$ $HD$hAE|$\uH=p'f^H_Hu<pV H5A1sDžxAŃt u~-DL$9"H$ D$HD$hоDA[fDHDŽ$`HDŽ$h HH$IcH$H$`H$AE$H$@D#kH~H1 LH$rL$$1H$LH 1JOD~,H\$HLl$PHl$`Lt$pD|$x|$@W,H=з+.|$XH=&H6|$@H\$HLl$PHl$`Lt$pD|$x,L?L=VLUm1L@H= LH=LHt#L¾?mL1Ҿ@H=vKH=~H$H=1AH5W:H=޶H51AL$MLEH=]HTH=LEH=HSH$H5̈H=]1A蠅H=I,H$H5xH=>H=xsH5>1E1LH=]11Ҿ (H=1ɺvJH$H="tH$A11LIGH >;IzH=H5ݜ`H=q+L$;LA;$H=JH5`H=7+LA:H=p1ɺ!IH=cH5|1=H=L= Lb%H=#HnLJ%aH=H5W1$1ɾ}HIH=9H!$HT$hH5AH=X裃!$1ɾ4HH=H$HT$hH5AH= VH=H"l~mH=V~J$1ɾ~~HH=oHe$HT$hH5AH=قWH=}H5dv1A蹂H=b)+H5 v6H=EH51臂dH=H5OJH=jst$xH=T> 1ɺ*G11Ҿ,GH=M1ɺvhGHD$ H=H5uAE1]H=v(H1W/5HD$1E1AHD$1E11At$xH=۾>.=bt =yt*=NH^H=VA|X6Hq=qH*tH=@uMH-HuH=H5A׀UH5 `H=oH501豀H= {H={H=1ɺ!Eb1ɺ*E?11Ҿ,E,H=H5HHcT$PH=~1ɾ|zEHKE*H$89D$XcCH5$tH=j`H=v&H=ͻH5V1HD$1E11HD$AHD$1E11HD$AH=H5oH=KH5'D$DH=+H51H=f1F#H=HW1FHH=H52~0|$@1-IHHqLK7H=@H\$HLl$PHl$`Lt$pD|$x%|$@#IH$*BH$8UH=I%j9D$`H$p|$@tb|$@ ^(Pd$HFH$86UH=$|$@#H=ݹH5}O(H$ iT$`t$P1ɿ H$.D$@uT$`t$P1ɿ.D$@H$HD$pDAUIATIUSHHdH%(HD$1XFHpmH1LdHHH1ɺHHHHI$LHHGL^LH$tDžxHA rHD$dH+%(HL[]A\A]f.HHE1LXGIHdHHfH=H5k1{Hc=wʼnnuf.A1E1L,HeH$ dH+%(F HĨ D[]A\A]A^A_f1%9LH5H=1yfDD$#D$ADADADADL= L$HH= LH5)\fADD$XfH=ĩLLFH1xZf.D$dCD$83D$`#D$\HIHD$PH1HD$HHHD$@HHD$0H=脛HɨHD$HHD$ gHHD$OHHD$(7HE11E1$vH|$H|$hZHHFHii1L{HfH=yHT$$zufDH=iL1E1H5˟AE1oL$L,hHD$(dH+%(H8D[]A\A]A^A_fDHH$ADžOD19q\$$H|$1ɾr<IH1Ƀ11H&IML;L^HH$Ht(H7H H4$L7GL$EÅu E1T$ H|$1ɾw;IHT$bLH%D$KH{HL1HD$ B=HLBD^H=H5Am@@DuD@ED$f.ED$fH9HD$H!HD$qH= HT$  LDLE1E1E1'1E1A9H5H=oHXI D t$D$ =uWLLE1%H=jH5@AlH=LH5ޑ1E1AlH=)H5"B1AelH= H5AE1DlH=LL 7\LL*LH=H571AkH=LE18EA:HLkbH54LGAAuL1E1E1H=Lt3H<LdeH|$ eHD$dH+%(LH(D[]A\A]A^A_@D91E1AH- @MH5L8)LH5^@HɚH$D$ H<$HtwHt$ uiH$H5>H=5bfLH5H=11E1AidIHHZf.H|$HT$ HH%H=ߙHIHH)LH؆H=HHHIaLH3HLHLIj;H=H5THHHHD1hH`H=mH5H1hH1H=MH5vH1hH D$ H H=11E1H5AShf1AYH$(LH$H=HIHH(LH覅H|$L5rHKH=kHLHm`HH2HH|$KHH=eHH51LAE1gH=AD|$ H=&H5g1E1A_gr7DATAHUHH#+t uAuH,HD]A\DAWAVAUIATUSHdH%(H$1H\HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$HD$ eEAHu2H$dH+%(lHD[]A\A]A^A_fDLIE1HHODA@E1H/H-HLD$PHD$8H;HD$hH$HD$@DŽ$DŽ$D$|D$xHD$`HD$XHDŽ$HDŽ$HDŽ$HD$H$HD$(HDŽ$HDŽ$HD$pHD$0HD$HDŽ$HDŽ$HDŽ$HD$HD$HH$  '.|(wHcH>D$PfD==~/#wHcTH>@=DA=@#whAHD$=FEH=Ɣ1bHD$HH+HD$1E11HD$E1E1E1H$HD$8LtR$DHQHD$pH$H=1&7HT$8H=H51^cE1HD$HD$1E11H$E1E1HD$8LDD$(LL$ H$LL+H|$+H$H|$ H|$LH<$5H$HH$\H$NH|$@^H|$8:/H$-/H H|$H5H|$HU?DD$(HH$L@H$HH$$@D$PHxAHD$hH= @E1HD$qEt Av AvfDEt AS ASfDEt A"* A"~fDEt A A^fDHّHD$GDŽ$0D$xD$| HH$@HqH$@HYH$@HAHD$H=)H$'f.H|$0tVH|$(M Ht$(L&UH|$ Ht$0H|$2HD$(HHD$0 HHD$`HqHD$XHYH$H|$(t`M/ Ht$(LHL$0HD$(HHEH|$HD$08 Ht$0H|$IxHD$0HHD$(OHɏH$4@HH$@HH$@A@AAA AAEt A5A5fDEt A$)A$ffDAWH=ю1ҾHD$@3A$@AÀ@HcH1H,H}tHHH8uAHH|$XHtH$.H|$`HtH$oD@D$XWH|$0TH|$(4 MC Ht$(L H|$ HD$0HL$(H|$HHEHXH|$tH|$1HD$H!HD$(HD$0D $AOAŀtDŽ$u DŽ$AH|$Ht 11H$L  H<$A" ˆT$`E1A"tAS8 HD$D$`H$$H$1ɾrLT$0X)LT$0HHD$8v D$EH5%H|$ =LT$0HH$H $=v =C  H|$8H$LT$0=.LT$0HHH\$pHt:H$LT$0'H5CHLT$0HH$H7$H$1ɾwLT$0X(LT$0HHM A$ A# |$XD̀D$0AS Ld$ 1Ld$(Hl$PH,$Dt$pLT$XL4H|$I4L11LIkIH% LD$@HL$1L$L -HH DD$0H$HLH$FIH L H10L9ADt$pH$Ld$(LT$XLd$ H,$HHl$PASDl$01H |$`"A$ EIHLT$ H$H$6@LT$  H=҉H51YH$H$D1H|$(LT$ IHH5zLT$ HIE1HH\$ LLd$(LEIMDHA 3HH.HA9|ILLd$(H\$ LLt$(IH%LT$(LLT$ E1 LT$ E1E1fL"A5t)LA"tAL}HLDH HT$8H=H5t1WHD$E1vML>A"t#LIA$tAL}H%LDH L{A5t)LA"tA$LJ}HLDH ۚTL9A5t)gLȚA$tAL}HLDH LA5t6LnA"t#LyA$tAL|HULDH 'LJA$t)L+AtA"Lw|HLDH @QIHGf.QIH'f.kQHD$HKQHD$HHD$L ;EA"u A<H|$H|$1E1HD$HuwH=EH5"1UE12HT$`H5ÅH=AvLxH]LD#AvLwHBLD@LA5qASLwHKLDVHD$H|$0mHD$(H$HD$H<$H$HD$0BfDDD$PDHt$8L׀L H$ELD$ LT$ DEDDl$0BLT$ H$HH1H$Ht HL$hH1LT$ H5O  QLT$ H$Ht HL$hH1LT$ H5+ PLT$ H$Ht HL$hH1LT$ H5 PLT$ $=LT$ = L$0HT$8HH$<$ E1E1E1$1E1E11A2HT$8H=ހH5'm1 PVKHD$8HHD$L$xD$LT$ L$H$t$|H$ LT$ HIH5dHLT$0HD$ rLL$ LT$0$+H$L1E1E1A_ML$$Dt$0H|$#H|$11LH$L$ L$H=LT$ 11E1H$LT$ E1HD$AHD$8HD$1E11H$E1AHD$8H=W1LT$ 1H5lE11NLT$ AE1rH$E1>MML$$AHD$1E11H$HD$8"H|$811LT$0H$OLT$0HH|$8H$LT$0H$SLT$0HH=~H5 k1LT$ MLT$ 1E1E1AH|$0D$`HD$)H=.~H51E1mMHD$H=~1E11\H$E1E1HD$8A"Ld$ LT$XH,$1Hl$PAH,$Ld$ 1E1Hl$PLT$XARA@j$dDLT$P11@D$0AR5"}LL$0HL$HH$?HH$IY^LT$PA1M"H$ރ&H$H#H$89|MH$D$`"H$11E1AH5iH=|1KE1LT$ E1ALT$ H$L$0AvHT$8HHLT$ 9A5HHLT$ E1aCLT$ E1E1FLT$ H=|H5h1WKE1LT$ E1A9H4$HT$EHLT$ H={LT$ H5hH$HLT$ D$0T$0Ht$8LT$ -LT$ tH$wDl$0xA1E1E1LT$ H=>{H5{&L$0HT$8HH$DLRLLLH.A=]%9=tN1ɺ H+)v!t1ɺH(11ALLH=L|$ 1LHHFD1[H5`H=sBH=ys9 HD$dH+%(u?HD[]A\A]A^A_H59iH5iH5`H5hH5hff.AWAVAUATUSHHL7dH%(HD$81IFMnD%~I(HD$IF0H$EE11DZ~t"1A LHH   r~LLHHDHL$LLHA~Ab=~%9I=}tN1ɺ H&s}v!t1ɺH&MH $11ALb}H =X}t111HL6}AoF8HL$ H߾)D$ ?&=}L|$ #}1LHHD1]H5^H=p:@H=p>|f.HD$8dH+%(uZHHD[]A\A]A^A_H5fH5fH5lfH5fH5S^xH5flH5'f`AWAVAUATUSHL?D%D|I_IoEteMoPMw`E1Bf.IGHA$HLHIGP{I<~6{At={%D9HD[]A\A]A^A_H=oH5f1A>H=oS{ff.fAWAVAUATUSHL?D%d{I_IoEteMoPM@E1?IGHAHLHIGP{I<~6{At=z%D9HD[]A\A]A^A_H=nH59e1A>H=n szff.fAWAVAUATUSHL?D%zI_IoEteMoPM`E1?IGHAHLHIGP7zI<~60zAt=z%D9HD[]A\A]A^A_H=mH5Wd1A%=H=m)yff.fAVH5|nAUATUSH@L7dH%(HD$81yM6I&L5IHD%`yf)D$)D$ EtaE1Hl$A.yHLHHT$A I6HD$~` yAt=x%D9H5cLHD$8dH+%(urH@D[]A\A]A^H=lDH5&c1A;H={l@xH bLH5k1H= { AVAUATD%?xUSHHkLkHØLsEtPE15DxHLLA$H<:~6wAt=w%D9[D]A\A]A^fDH=kH5db1A:H=k[D]NwA\A]A^AVAUATD%owUSHHkLkHPLEtUE1:f..wHLLAHLFEtLE1I.DA LHLH~M7uAt=u%D9HD$(dH+%(uOH0D[]A\A]A^fH=hDH5V1A8H=hteDAWAVAUATUSHL?D%tI_IoEteMoXME1?IGHA$HLHIGXGtI<:~6@tAt=!t%D9HD[]A\A]A^A_H=gH5^1A57H=g9sff.fAWAVAUATUSHL?dH%(HD$1I_IoD%sEtdME1I?IGHMGXHLHH$YsI|~GQsAt=2s%D9HD$dH+%(uFHD[]A\A]A^A_ÐH=fH5]1A56H=f9rAUATUSHrdH%(HD$HD%rHHEtJE1I,LHHAH$6`rt=Er%D9HD$dH+%(uHD[]A\A]AUATUSHHqD%rHHLАEt8E1LHHAqt=q%D9HD[]A\A]AVAUATD%qUSH/LmLuH`HPEtlE1QDVqE1111Hf.@ATUHSRHI(Mt"~ؙu.[]A\fH=)\H5f1k+[1]A\@LHH=\H5 qH1@+[1]A\fATHwMUHcSHH H=[t~AH5eD$HeHD*fIcf*D$HTmH HP* H>h^Y H[]A\HH5ae1*H=([fH[]A\AWAVIAUATUSHHT$dH%(H$1D$,D$(HD$0HcHl$8L|$,E1HiND$D$fDH|$ILLALHwH|$8)H=LZH5{d1)H=7ZeD$D$ HD$@H$H<$1E1E1Hl$0HHD$LH8t^Hx1HlH|$0`HD$Ht$(HJ|(Hc|$(L$(IHJ D@A9DLINL9uAKH4$E111A|$]5Dd$1d@xLHD$H= YH5OcAH(1V(H=XZD$ dHNH9HD$HH8tLl$0Hx1L'H|$0HD$Ht$(LH|(H|$0u$Hc|$(L$(IHJ#D@xH|$ANLLHHwIX'FD$,yD$HD$AH(HNH9$Dd$L$T$ H$dH+%(D$H[]A\A]A^A_f.uD$,fD$f.INL9|$tD$ H@H=QWH5l1&H=;HH;H(HHH[H]ff.@9USHHH>HH;HHHH[H]/ff.@w5.UHiAHHH=RH=]HE1!H=R11Ҿ ]^3ΕUH hIHHH=PRH\AHE1!H=2R11Ҿ T]'^fnUH\HAH\HE1HHH=Q)!H=Q11Ҿ ]]rfAWfE1E1AVE1E1AUL-ATLU1S1HdH%(H$1f$HOxfD$,fD$fD$fD$)$)$P)$`HDŽ$HDŽ$HDŽ$ DŽ$(Ƅ$.DŽ$HDŽ$DŽ$h DŽ$Ƅ$DŽ$Ƅ$HDŽ$HDŽ$DŽ$)$pHDŽ$DŽ$f$Ƅ$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$P)$`)$p)$)$)$)$QD$ HD$$D$(D$@D$XD$PD$$D$ D$`D$8HD$HHD$0[t@== wHuHcH>D$8uH=pE16H=NH5HIl$H&fL(8ExCxHHCHn8H-4EHCƄPHH=O[L-=HqHH=5[IDHHCƄPH{>HH= [IDH[HCƄPHH IDAL*D9DLHI+H5HHHCHnAL=H=`XH-/DL-SHI?IHCHƄPHbIDHI9uF@HcH>D$(D$@QE1E1:HT$H=LH5Y1HT$H5,LH=L1E1E1H=LL=NCD$DŽ$HD$HD$HD$(D]D$`@HT$H=DL@1H5Ye@#D$PHT$H= LH5X1MD$($HKHD$H9˺D$$=W_H=KHT$H5leD$(=WLrWD$(s4WH=YKE1E1L=BD$(D$DŽ$HD$HD$HH=ǂrL1H-H=sLH==t"H|uLHH9wMtH5UL]1H=cH-\t)f.H|yLHJH93wMtH5mL D$$t:D$t2HL$HiNHiHOfH}HNH9u닄$H|$LH|$HpH$H$fH|$0H$dH+%(OD$(H[]A\A]A^A_qU@$)=H=fIH$ɴH$DmƄ$)H=IHIƄ$H;TIH=HHHƄ$,HR;ekTV衷D$ $H$H#.y$$hD$aD$XH=AHHD$0HPf詩3@裴L%TMYHT$1E1H GH=GH5a%)H!HPHnwqLƄPH-b>L-HHHHCH܊IDH=^GHJGH[SH=GGH5Ha1E1H5Ll$1 H=PH=FH5"HIl$HL(9WLH辿H5HIH5SLH5SLH5SLH5ySLH5LyH5QSLbH5BSLKtwH58SL8tdH5L%tQL=IGH= H-x<LBƄ<HHhL5a}KL%AID$H=p L=yH=APH-<L5}fL% I?IID$HBƄ$H@KHL9u(L%ID$H= H-;ID$BƄ$HH=QHL5v|HKL%cH=QBƄ$ID$HGKH5zLl$ HcCHCD$pHH8HD$tHD$pH8um9LHH9u~ (HH9uH0Ht2H$1HH>9LHH9u~ (HH9u\$8hL$M)Ld@)'D\$$E&DŽ$L$$H5?EAĉD$MiNL@HD$H&H|$L1ӿD$ H8#F=n=Dx@D$HL$L%hMHYLiNJ1OHD$hDT$$EtHHMcﺲH5?LIH<LCH5>LyIH<HcD$`HSLC H5>IHHD)HSHLCHC@HCH*IH<LxH5d>IH<LH5;>IHf<LH5>IH(LHNH9\$hDL$PE'HD$QL` J0O0I<$L1INI$L1I9tI<$LI<$LDCAƄH5LLXEWHT$L1E1H=F<H5IE1 fD$Af$CAƄEAƄEAƄ=CAƄ&HAH$f$Af$Ƅ$ADŽ$f$$Ƅ$ADŽ$_HADŽ$H$H=:H5*U1E18 <ƄA11ƄArH|$H1ҾJ|$p$HD$HH$HD$Pu$) $, D$@ D$("DŽ$HD$PH$/8$HH9uw }bH5$Lt$`1L$0L=+EL-%AEE;D$ HPI?4$LHT$|$$LHE$0HEaLaۿHE$0Hff1H+PEH*H*^D$hD$h15E*2DLt$`$D1L$0L-ADD;D$ HOH=P*4$LHT$|$$LHE$0HD\LA[ۿHE$0Hӿff1H+JDH*H*^D$`D$`5DD E($C1L$0L-^CC;D$ HLH=U)4$LHT$|$$LHE$0HCYLAXۿHE$0Hоff1H+GCH*H*^D$`D$`5CDE($B1L$0L-{BB;D$ HIH=Z(4$LHT$|$$LHE$0HBVLAUۿHE$0Hͽff1H+DBH*H*^D$`D$`5 BDE($A1L$0L-AA;D$ HFH=_'4$LHT$|$$LHE$0HASLARۿHE$0Hʼff1H+AAH*H*^D$`D$`5ADE($@1L$0L-@@;D$ HCH=l&4$LHT$|$$LHE$0H}@PLAOۿHE$0Hǻff1H+>@H*H*^D$`D$`5@DE($?1L$0L-Һ??;D$ H@H=q%4$LHT$|$$LHE$0Hz?MLALۿHE$0Hĺff1H+;?H*H*^D$`D$`5?DE($>1L$0L->>;D$ H=H=v$4$L}HT$|$$LHE$0Hw>JLAIۿHE$0Hff1H+8>H*H*^D$`D$`5=DE($=1L$0L- ==;D$ H:H=[#4$LzHT$|$$LHE$0Ht=GLAFۿHE$0H辸ff1H+5=H*H*^D$`D$`5<D E(@0$c0I R$tfHD$L=NXH 7H(L,(IܺLH9I$H_h l<H;HNII9uHD$E1L=!L,(H$#HD$hHL$hAD$gBPHIމHHHL$pI& LHINIL;t$`uD$h53D*32;D$ Lt$x$,.$-,$.#1HD$HhJ0OH}$,HNH9u2HD$J0HOHL$`J0NJ0POH $H$HL$hH ]HD$x1HL$8;2227HDŽ$(t҃|$X:+IHtHJ_8LH$]HDŽ$H=%H5K1H=%j1H=%H5J1H=z%՛s191ƄH=V%H5'J1H=A%蜛1H=+%H5I1mH=%q10HL$hHH)t1HH9rH$(蓪HNL94`\HL$pHNL90@\HL$pH=$H5?HD$HL=)H=h$ÚD$(HD$D$ HH`LHHL$H$f.H,LHLΫH-L身1#H$fL4$fI}ISI}0JI}hAI5M9uH8LLUH9LALt$I}IM9uHLHHHI}II}HM9uLkI}IL9uH;E1L,H{#H{H{H=ftuI}II/Ip#IIPeLCIfL/I@gLL95ewE1H=atNDJJ&J.JFmLIL95awH{ oLHNIN蘩H0pL脩D$ D$ HD$NH$N;D$pE1E1gH=~!H51H 0HH5 1H=&9聍H=E!H51H8-L=H4HH-B1L$0-,,;D$ H|H==4$LHT$|$$HHE$0H,D-LEHE$0Iff1L+-v,H*I*^D$8D$85=,ڿM)L=-$H$$(HL$HD$8L$(D$ HcD$ H5 IlLceLDIHDeH5 AMcLHD$PHåHHpHt$11HL$>H讳… HcغH5 HIHLHE111LH謠sL=HLLZH$0 H$H|$HD$@HD$8L$0HD$(D$XHD$(H|$@$AtLbtH$0Hg*Y*D$VD$EHD$PL HL$8H$0H$@ *D$) )ED$89D$HD$(L HHݼIc\HѼϼHDŽ$0H$8H$@DŽ$H[ L\HH s HؾffdHt$PLH 1D$XH=V,G1LT$`T$`HÅtH$0Hff1H+(H*H*^L$`N=_T$H&H5&D$`H=hH wHD|$XjHD$(ffH -*D$^D$`A*LYHHD$(9D$ ~=b_H "H=+1L%(ALL1H=|H9\$ H5f 1L%'LD$@1H=EH4+H,H=!LظH9\$ H5 ?,LLH|$P-LݢH&D$(<H=GH=[*1:H=71H kH=c*L%&ALL1H==H9\$ H5' E1H&cHL$@1H=H*t5B4$H+H=Bf/$vdH)^A.ID9d$ =;]H=H5_)1 o%D$(HھH=(1超H=(襅|H=A61蒅OH z(HH51H=1nH=2H551L=mH=5<H=`51)}H 'LH5H=0JH 'LH5a1H=0D$ L-?H ?D$ H $H5(H5X(H=e1H=MH51H5 H55H5](H5t5H5H5H=1E1E1H5259H$H52H H p%LH5SH=|/׃H|$P1L=* Ƅ$,Ƅ$)3I<ڷu HD$PHH u IHcD$PH5L$HD$hL?HD$`HBH$1L=#HD$xH|$x H=A輸H=u11Ҿ 藇rz$HL$`L$1HZ|H;\$huHK,$E1HD$8HKHD$pHJH$HoJH$HD$`H5EB<IHH$LHIH HRH$0Ht$+DHtJH=kH5/1HD$xH \"1H5H= ,eLD$x1H5"E{f;+FH$0;+F2:f;+F3:-;+F4:;+F5:$;+F6:;+F8:;+F9:;+F10f;+HWH=DH1H5)/{:dH$0H$E1HH$0H$(H辪kHHH\$HHש1H Hc$(IcAH@HAXD9l$ H\$LIL;|$hH|$`L=] ,$LLl$HL$0H.TfzLt㋄$0ƒu <~H=8H1~9l$Pu=Ut^H5bH1(y>Hf葲H5#H1xH9 H'HD$HfH$0H$HH$0@H$ HHH1HILc$ HILl$8AXEAE1HAXEHAEƧ1HAXEHAE訧1HޞAXEAEH$0H$HH$0mH$ HHHH@1HvLc$ ILl$pAXEHAE1HGAXEAEkH$0H$HH$0֦H$ H聧.H豦H試H衦1HםLc$ IL$YH$0H$HH$0^H$  H H9H11HgHc$ HDX~H$0H$HH$0H$  H蔦AHĥH輥1HLc$ IL$tH=H5*1DREH$HD$hH$HD$`H$HD$XH$HD$pH$HD$xH$HD$8H$HD$PE1L-DII\HD$PDB< tOtID iQELH51u55H[Dt$ 1H-H4$.H5tOtD9sLHDf/$PwH5HHDH58^#5nt렿 bLH51Gt.H$L5 H5IHH$H=/1yL%CH- I1UA\$AT$DH5AL$A$MsHI HHHD$hA݀<tDLOEu=OA|$At$Al$A$$Ug33H5.3 3^^^^rSH= H5o1|HbbH5-1rDL%B1H2kHD$XA<(tE5WND DAL$A$H5.DrIHH+FL%@1IH+AL$AMDA$H5qHIIH HD$pA<(t܋MuMA\$A$AUuIMB2H5- .2^^dqzH`H5,1;q _MA\$A$ 1H5,f(^^pHl`H5,1p E1H-?H M1 DBDH5^opIHI HD$xEB< tD5uLEu 0BDDZLf(^EuHKf(ȿf(H5_,oH{_H51oL%>H-oC1HD$8A݀<tKDrKEpDM LEDAL$A$H5ZoIHHHBE1H-==HD$`EB< tMDEKEpD /K DBDH5^nIHIuH=JD$@L-/2E1H$PH-=GD$ HAUD¿AMAEH5QnIIL95jJtB<3Et|$ uڋ5NdNJu DJAmAeA]z .LH5*f(f(^^^mkHD]H51ml H.BD=IS f(^Ѕxf(H5f(¿Rm|H\H5=)1)mD LIA\$A$HMU Et- -H5b)^^lnH=PE{D$(L-4E1H$H-"=D$ HAUD¿AMAEH5VlIIL95D B<3Et|$ uڋNdSHuIHAmAeA]z ,LH5(f(f(^^^kkHI[H5k(1D4$kD$izH[H5(1D4$rkD$8DjlH=#H5yL=1\H|$`Lʋ=WGF$D:$tl$L=`H|$`LFբPH5H LH5H='oH5{:vH$0H$HH$0H$ H茚9H輙H贙1HHc$ H 8X{:H$0H$HH$0bH$ H HL-+61HlHc$ HkIHAXEAE 1H?AXEHAE1H!AXEAEEH$0H$HH$0谘H$ oH[HL-y,脘1H躏Hc$ HkIHD$xH p1H5H=HmLD$xHD$xLL1H5H=ymLD$xRHD$xLL1H5H=OmLD$xDH= H51L=DHD$HwHD$xH 1H5lH=lLD$xjHD$xH 1H5<H=elLD$xƄ$Ƅ$*}@HD$I RL='H H(L,(IܺLHI$H7  H;HNL9u2H=zH5L`LRHH.H _HL1HH-Y7H$LHE71H,H5hHHcH$Ho$H'H5h)$o$H$)$H$Ho$o$H$$$tDD$o$H$o$H$H$H=6iHL$)$ H$@)$07 1L$0H-p g ;D$ HH=34$pL2HT$|$$HHE$0H, YLAۿHE$0Hvff1H+ H*H*^D$`|D$`5 D áE(HD$H0J0(RH}HN薀H9uH$oHDŽ$zINH |M94 1L%لH4襠 HH=4$L$0D=/LLL$hҸEHT$LHE$0|$$H螡H|$hAljT$`藸T$`HE$0HD$` HT$`f1H+fH*H*^D$` D$`5BD Q/HL$!H(9D$ L=1L=DH4irHd4Hcb3$I<ިL$0-LLL$h蓷HT$|$$HE$0LH`H|$hʼnT$`ZT$`HE$0HD$`̂HT$`f1H+BfH*H*^D$`D$`5=2HL$H(9D$ kH-7H1HHHH$0H$0H$(HHHD$L`PD-z1zKDID$I$_I|HX}>IL$A$LIt$I|eTINL;d$`"H$(y豙H$H]!H5!cHL$趠H$Ho$o$H$)$)$|oH$Lo$o$DD$H$H= HL$H$$$ٚ`*1L$0H-;D$ HH=t4$+LӴHT$|$$HHE$0H蠝LÉT$8蜴T$8HE$0HD$8HT$8f1H+fH*H*^D$8D$85GڿWT$Ht$LnIL%LrH$(LHDŽ$(HctH$(H$(gCHH5L$HdH 1HHHH%/1H$&H/1HH5RRHHH$H HHcHH5u`H$ HHlH$  HDD$HL$LH$H=xa1L$0H-5~;D$ H3H= 4$豣˕LsHT$|$$HHE$0Hm@LÉT$8d둿yH*drxHdSxHc0H521MH5H1y o\xHcixHcff.ATUHHY JHt5HHI'Ht"H=˫HLH5}]1A\{H]A\'(ATUHSL&HMt8LH[uCHSHHs[]A\O[]A\ff.AUIATIUSHH$HHt3LH`tbHL' H[]A\A]H=ɪH51 zH=H51yH1[]A\A]fHfDf.AUIATIUSHH#HHt3LH_tbHLyH[]A\A]H= H51KyH=H5516yH1[]A\A]fHfDf.ATIHUSHF11H4H=LIHHH51x[H]H5>A\)1fAWAVAUIHATIUHSHHAfHIjLLHtHHHLHN:tAPtH[]A\A]A^A_ÐHHL[H]A\A]A^A_H?0u H?0tQfH(QUHH1SH5HH=dwHtRH=SH51S$HQH=,HBHg&9|H[]@H=HH5([]?Sff.@AWIAVAUIATIUHSDHDLLH1IE1hZHt4HHx"LH(:AŅy)u]AHHD[]A\A]A^A_DLNHIaH pLDL뤐HLE1mADAWAVAUATUHSHLf MLHE1oHfAHD$(dH+%(yH0D[]A\A]A^fDL- L%N\LL"oIH=HHHHhHl$@HI9r fI9tCHDB uH @HD$HDJ u:L@HHP1A>IEHT$H$: H=HH5D$iAŅKD$LL)f.HD$(dH+%(/H5աH=H0[]A\A]A^mDH5Ht 1>HDHD$(dH+%(H=hH0[]A\A]A^W'HiAH4E1fHD$LH5ݠ1E1H=1H$H51E1H=iH$LLt$HL$H$H5p1H=x@ATIUHHZHHLgHt3I?HL>x(H=tLH]A\fDH]A\dU@H=9LH51xoH=!|H=duH52LlHGHuH=LH5V,oH=՟X]A\,ff.AWAVAUAATUH-S1H=DAHL=AOMg1EDDH=9H=AHIĄuFMuAHLt=yH= LH1E1InH=M:tMAOIt:t@H=96HD[]A\A]A^A_H=LH1E1mH=fUtSu?H=H-:1tH&H=4uHWjHH}]DH=HtH5H,]fDhHdHHu1]AWL=\AVILAUATUSHH׺^H(dH%(HD$1iH:HHE1EIHtIL.IH5HMAuJLDLLӺ}LHA%HD$dH+%(uzH(D[]A\A]A^A_H5H9ME1uAMtLHt$DD$ HD$MHrLI$LLl$DD$ UbHHH$dH+%(5HH[H5]A\efH$dH+%(HI|$[H5~]A\eH5 LIH=B1KH=4z HHHH=@H5!1hD1@HuHtHHuMtIEH[]A\A]1fAUHHATILDUE1Ht1HIHt L]A\A]H=LH51eH=H51eH5HHbIHuH=SLH51eAVIAUIATIUHHLLLH/Aąu#KHD]A\A]A^@K5HD]A\A]A^ff.AUI1ATUHHH=dH%(HD$1H$@HHHIX~"HD$dH+%(HL]A\A]ÐH $H=UHH~9H5T1dH=4Mt9LH5Q1ndLE1cA돐H5 1RdH=MuH5-18d4AUATUHSH1H H)\HI4HL1k`IHu2fDL>>HpHxHH;Aąt$L9|AHD[]A\A]ÐHKHSH511H=(scHD[]A\A]D+IAH[D]A\A]H=LH51E1%cPXHIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H=UHLH$$HD$HD$ D$0HD$DKH=x 7ff.AUIH5ɓATIH][Ht HA\A]LLH5bH=fDAVAUATUSHH $H HHHIdH%(H$1I LcEH73HHH5LZHI$LHLl$]uT@HcLH]t>LH^4I4$1HLCtLP AŅ)fI<$%H5E1xI$HV fDE1H$dH+%(u[H D[]A\A]A^Ht$HsBI$Ht Ic1H;D$tH=7D11H5It`_0H jLH5H=Ҩ-ff.fUHSH /Hƀ,tCHfDt]H,t'DQ tuUHҺHDH[]EHEH6HHDN uff.fAWAAVAUATUSHHL5H$`T$8H$PH$XH|$@HD$H$hLD$`HD$H$pDL$\HD$PH$xHL$(HD$ H$HT$HD$HdH%(H$HHD$0HeHD$(H|$HmHD$H|$HL-HD$H|$Ht HD$HH|$PtHD$PH8gHD$ E1HtHH|$Ht+HD$HH8AL$AIAEAAHD$@H$H$A HAHl$p1H59HH$,H$oD$pHo$H$)$)$UoT$po$H$H|$@$H$$^jH yILjHt$@H|$PL$AYAZHHEHD$PH D$HD$lL-PD$hHD$8HD$ H D$8H\$(Lt$HD$0H \$L t$HuMu H|$0GH=AądHIHtH<@Aƃw;IcDL>H\$HtLOHHHD$LCL@H\$HtL,HHHD$H\$ HLbHHVLD$lBHD$ H\$HLIHHLD$hiBHD$H\$(H L HHHD$(H|$H|$YL-=@H9A -A1H|$@l$8D\$\EZH|$@TE1D$\un*E1H$dH+%(QHD[]A\A]A^A_f.LXADP+t$\IŅ5HiTM(K@fH7 HD$H|$L-HH|$HD$PHH|$ AHD$ -DH\$HHLBH;HD$l0H\$PHLrGH;1H D$hLW@f.HD$ HD$HD$HD$HD$(H8ST$hHt$P1L-2L$lHOHND$HH|$(Ht$PHD$Hn|$\H=H5y1X9L|$`HMLLH=HLH51XHD$@HtH=[H1H5"X6H=7H51yXH="}pHJ@DHeL|$\Hl$@%H=1r:H=1IHtxHLHLjH5 jSHT$PL$-RH LHn$HHD$@bDH=QH5ʷ11WHiQHHD$@DD$\E2HD$@ZH=1H5GWHQM8H|$dHD$H|$L-HVH|$P^HD$ AHmHE1^H|$lHD$PHH8`L-QHHD$HH(H+Dd$\EH="H51dV߁H=H5{H13V;@[QHL$PHHDt$\EH=H511UOLH51UHT$`H=s1H5FUH|$L-"H|$L-0lH|$L-,YL-/HIH|$ L-6HL-!H=H511!UH=ŅLH5%1UCHD$PHH8;"PHT$PL-˜HH>DH|$tz#HD$H|$PHt HD$PH8t8HD$ L-7AHH=H5aTOHT$PHHuL-4H|$PtpHD$PH8HD$ L-AH'E1H|$ L-ޗyL-їH|$ L-AuSH|$ t#)HD$ L-+AH(H|$HtuL-/A#NHL$PHHAL-MANHL$PL-'HH%HE1E,Ht"HT$@H=1E1H5RHHD$@ff.fAWIAVAAUAATMUHHdH%(HD$1H$Ht-H52tnH5HtvHE1MLjDDHjjHD$ PjjjHD$@H@HT$dH+%(uwH]A\A]A^A_fH=LH5QH$@111H2H$HuH=HL1H=nH5[QH$y"@AWAVI1AUATUSH8H|$LHl$pHT$HL$1LD$ LDL$,IH1L-Hu-7DH+LLHIH 9|1HH-L|$1L HL$LLHADž8HD$Ht HH# HD$ Ht HH4H MHLDH='L1E1H5cPH8~"LOH8D[]A\A]A^A_DE1H=ހ9H=ɀLH5 1E1PH= LH@ AŅWH=vLH51AOD$,HHS.HI7H=9H5QD$1ODH=H51A_OLWA9DL)H=DH5I1(O=9tH #LHL$HL$H=j|1H(D;l$mH=H51NSMHH=gH5`LD1E1LN?f.H(7MHH='LDH5T1LbNLD|$,ff.AVAAUAATIUHHdH%(HD$1H$Ht-H5tsH5Ht{HE1M1jDDHHD$PjjjjjHD$@H@HT$dH+%(u}H]A\A]A^f.H=)~LH5jMH$@111H"-H$HuH=}MHL1H=}H5"MH$s@AWAVL5AUIATLE1USHdH%(HD$1A9@DL5'HHHh fH9H&Ht$H|$IuHE~LDIHtLHuHD$dH+%(uaHLH 1[1]A\A]A^A_f.LAA9HD$dH+%(uH1[]A\A]A^A_5DAWAVAUATUHFIHH7;11ҾgHI"HIhL=yLHL@Ht^HLC tO11ҾYLN"HI#LLH@HtHL t]LA\A]A^A_@HLE1]LA\A]A^A_AUME1MATAUH dH%(HD$1HD$t_HE1DjjjjjjHD$HPH@pLH5{HD$HT$dH+%(u:H ]A\A]DHLLHL$L $HL$L$HIvAWE1AVIAUAATAUHSLH(dH%(HD$1HD$HAILjDDHjjjjLT$@ARLT$@jH@LT$H|$t[H5{LHD$HT$dH+%(udH([]A\A]A^A_HLLHIeHE1ILjDDHjjjjjAROH@saAUIATMUH1HdH%(HD$1HD$jjjjHD$(PjjHD$@H@HuHT$dH+%(uVH]A\A]HH.t H$H=ylLL1H=xH5AHH<$1ff.@AWMAVAUIATMUHSHHLt$@t5H5H5dHLLHME1jH11jHISAUjjjH@AMtL_HxLH;Et}MtIuL1HL+1 L!LHHL9|fH=wLH5w1E1FHD[]A\A]A^A_H;hHff.@AWAVAUIATUHSHH(HL$dH%(HD$1HD$AIHHL|$HIH1Lt$LMI1HZYLt$tdLLz.t;LHD$HuHD$dH+%(uEH(L[]A\A]A^A_E1H=vH5 1ELNLE1C뱐E1fDUSHH H:j@E1jR1jjjjH@u@u H[]fDH;D$ HD$ H[]f.UHH5SHHHuH[]H5HuH[]H5HaA1Euf.HH AWAAVAUATUSHuH[]A\A]A^A_ÐHHE1BILGA9fDDLHIHHHƃt/At=fH8H0HHƃuٺLHtLAA9xH5<LD$ 8D$ H[]A\A]A^A_D1ff.fAVAUATIUHH=lutrL-[uHuH]A\A]A^f.+L%H=1L5aMtILHLHLH]A\A]A^DHtHAL51fL1VHHILHHLi]H5tA\A]A^fDL5HLfSff.ATUHSHuAău[]A\DH1HH=rH5HIcHHH=rIDH5y1A[]A\AWMAVIAUIATUSHL$DL$ H-rIHqH$MMM]|$QMu$t$ tHL[]A\A]A^A_DcLH8HHt@H1LIt$E1ZYuH=qMtLH5 @fH=yqLE1yu@kLHHHtMHLIt$E1HZYHIE1t$LH߾AZA[H=pLH51@H=pAf.:LHHHE1MttLZqH=kpLH5ȹ1?H=SpfDHIE1t$1ҾH&AXAYD1ҾfAVAUIATIUHSHHdH%(H$1IHHuAD=IILHCL16.H5LgHH1LIHHHA!H5HHtL#E1HLH$dH+%(u~HD[]A\A]A^@H=nH511)>H=nE1E1'D=ILL(H=nH5Ÿ1=D@AUATIUHHt;1ɺH7)t0Mt>LHE1HAHHuE1HD]A\A]A1ɃHD$(H|$At'AMtLH|$E1mH|$HAHD]A\A]ff.@SHH1L۵H Ztfu[fH{LH HruHCH=.mH5HH(HP L@01d<'fHCH=mH5^HH(HP L@01;H=iHDH5P18+tdJ% 'ADIAA"E1%AfNE1AfDHADAVAUATIUHHSHHH=LkL5iLL81IH111!IHI)CHQH9wFHH9t A,uH9tJHH)Hw[HAHH)A)HE HQH9vH9sUI)Lm[L]A\A]A^HFHHE1[]LA\A]A^ÐLLǺE1[]LA\A]A^LǺLE1H LH5[g1H=ff.fAUATUSHxdH%(HD$h1HD$HtPHIIպPHt$HHtQHt$HLIjH gLLf:+ZYuD1HT$hdH+%(Hx[]A\A]|$UNDEu1f|$FLDLl$1Hu+DH~LHI ~H9|H=fLH515H=yfK*f.AWMAVIAUIATIUSHLL$HŅt?HtLLLHyE1HV+HD[]A\A]A^A_@LtH\$ALH cHʯH۽trLLwD$T$E1HH LHA蘽AZLHE1AAff.@AWIAVIAUIATIULLLHHE1k~HLE1AH;*]DA\A]A^A_ff.AWIAVL5NAUIATUHS1HHu)3DHVLLHI~9H9|H 3dH4dLLH[]A\A]A^A_/H=AdLH5713H=)dH[]A\A]A^A_H=`H=`UHSHH=`uHcHH[]ÐAH=r`AtiAUATHIHtAH=ɭcIHt-H#LHL1ҾOHI~HLA\A]f1YfATIUSHMA<$-C<HHrwY1a.LHux8H bIrt!H QjwtaH H٬HDH=vbLH511A|$Mrtu0HtIH[]A\H=^ :tHD$ HD$H[]A\fD38 rHhH=aHHH5>HE11H=aH1[]A\H5oHHDH5HHDH5vHHDu H5bH= ff.AWAVAUATIUSHHHt$0D$HT$8L$ HDD$$IH`LL$(E1jjH$NY^HT$ HŅ4D$$xD$ E1H2HIHfHXADmIAPH5Q`1DDHuH=ţA2JcH>$a$RfLAH IH`H88$H=_HMH5&DD1Hv躬H(*D$ HH[]A\A]A^A_D$EgD$E>LAHE1E1jH=H11_LAXD$ED$ELARH=SH!LfD$Q$LAH=HLovf.$$BLAH=HL&f.LHD$LHD$fLL$DDLD$H5]I1HMtH5]LD1HުH=.u)H$1ɺw[H H[$lLApHHAE$$$Pj$P$PLL$hDD$dL$`HT$xHt$pLD$LH@H=\H5§1A2,LD$ Hc D$ LAH=%H%LLH=Hi$ZDLxH=ɟ11H$&LH=11HED$ELPH=a11HD$EyLH=)HY$Dt$ HH=e[D$ H=I[D$ f.t$$Ht Ht$(HcfH$H=ZH55*D$ NH=ZLH5b1*H=Z D$ %H0 H=ZH5)H=nZH5/1)H=YZD$ H$1ɺwHHD$ fDAWL=cAVLE1AUE1ATL%TU1SHHdH%(H$1HYHD$xHD$`HH[@D$@HD$0HD$8HD$ HD$XHD$HD$HD$HD$(HD$HD$DD$PD$T;tw|PwHcH>w͉VuE11AwfT$@f) DD$@uH=  H%XH|$8Lc=XHD$hHtHt$xu{H|$HHMtL1腼IHHD$hIAL$H$HH5KYJHHLIL]A\A]H=R]1A\A]%DE1]A\LA]@AWL=sAVLE1AUATE1U1SHyHhdH%(HD$X1D$LHD$PD$0IHD$4HD$HHD$8HXHD$(HD$ HD$H$HD$D;|wHcH>H=QHT$L誴ufDH=QL11H5PA 1E1E1E1L H|$PLL$L$;H<$HL"LLHt$HHD$XdH+%(HhD[]A\A]A^A_f.:1AEDAD1H`H1HHJH=sP11E1H5ISE1AE1L D$0CL1E1cfDHPHD$HOHD$8HOHD$(H-O@HOHD$HOH$H=yO1Ҿ-IDHYOHD$ oHAOHD$WD$4CH<$CH|$HtHt$PH $t$L9-u1yHEH$H<$MHL bCIHHHAH|$t&L|$LaHLHzLHmHT$PLH5HEIHH|$ 1ɺwHLHHD$1H5љE1^L LLL $L|$L $E1tH|$1IH;HT$(Ht$8HH$$L$HIHL$SL$HH&H|$ 1ɺL$w9L$HIT$0bHL$1L$IŋD$4L ՘ELLLL$E1L$'L$LL$HT$H5LH=A諤VH5NH=L1AE1E1L \;1E1E1AL B!1E1E1AL (E1E1AL H=VL1E1E1H5*AH=5LL$L ӗLHL$H=LH51DL$HHL$HT$(H=K11H5E1AH=KL$L I(H5(E1AL (L LHD$LL $E1AL $LD$E1AL ܖH="KH5!1L$`H= KdDd$4L$L f.U1Ht$11{~7H]H=JHHu4]H=JH5~1H=tJH1]Hff.AWAVIAUATAUSHL=JdH%(H$1HDŽ$JHHnL-HTLDLHPKAHnD$@DŽ$ID$D$tDŽ$D$pHD$hHD$`HDŽ$HDŽ$HDŽ$HD$HHD$(HD$8HD$HD$XHD$ HD$HD$0HDŽ$HDŽ$HD$xHD$PDDž|GwHcH>DD@@#wu1AE1L=f/yH詸tŃD$[Džh19AkbtH|$0HtH$wAu H|$H11LIH;H=GLH5I1 x1HILHUHD$0H|$0H5sHHx HD$0mH|$0CL{L9=4GtLbAAA)H|$H|$(-H|$pH|$ DT$1H|$L%SLEHEHD$8HD$0HG DL$@H|$01EHD$H HD$HD$H D$ HD$(H[LHMHD$H1HeIH1HIH1L4HEHD$(HEHD$ IHH5HH|$`t;LH4HHaHT$`E1聺H|$PtHLHHHVE1t$(LL$8HT$`T_AXqH|$htDLHHHP1E1t$(LL$8HT$xZYKHt$8HtLLLH|$xHt/HL$81HWKHHLGxH|$uL|$@VHt$L5A1H5ڐ菫E H=bH|$0L=H|$/H|$UL-EAEBAAfD1E1H=CLH5SC1AL=8HH$虿L`LHqH$dH+%( HD[]A\A]A^A_DD$p{HICHD$XgH1CHD$ OHCHD$7HDHD$0HBHD$xHBHD$hHBHD$PHBH$@LH6L%\ʾH6Ht#fDH=qBL1HHHu1E1L=E1yL=)BL@HBH$4@HBHD$8D$@ HAHD$DŽ$HAHD$`HAH$@HyAH$@HaAH$|@HIAHD$HgH1AHD$(OD$t;DŽ$(knH|$H1RHHH=@H51E1AL=+LH5"uH=@11E1AL=HT$0H5@1E1H=`;sLH5tD|$EYH|$t H|$ EH|$L$H1ɺrHD$H H|$1L=ZHD$(IMDt$t1EH|$8wIHtLHD$H=?H|$bH|$(XLPLDd$AH=S?讵dD\$E>HD$H5H|$($H H|$H5|HD$H1|$@H|$IH]HTHD$H<QIH IHt!1H> tLLO LoH|$eLE1芮LE1H=H>L=蜴H|$1 11LL=Dd$A1H==S|$@H$H|$(H5IHD$IHH$L IH(IHHHLLGH$LL H$LLL>vH$LLLXMHLLH$7HD$H HLnLLL(HT$XLLL-LLL׫LLLLLLKLLLULLLwLLLaLLLcKLLIH4LLĴH=;H51 1Ƀ|$tH|$8w~IHS$}LLH豪D$!H5ڇ1E1芢HD$HD$H=E1H=2;荱H|$8wIHz$LLHD$H|$8wIHLHD$HD$(H|$ ^HDŽ$M0kIH7H2t襵HD$0IHC_HD$HLBIHD$LMIHD$L@MAHLBHt$ H|$(LH$…H$LLLxH|$XHS1FHHLHD$ MLD$ .|$pH$LD$ HHD$@LD$ x1HL$@D$ <HLD$H*LD$HHIHHx>LD$PL=)LL$ A H59)A)AMcLL\$H L\$HLD$PHHHt$@IcIFHcD$ LD$HHLLzLD$H7$LLD$ LD$ H|$0LD$ H|$H$L辿H|$ 4LܽH|$uGHD$H D$(H|$ iTHD$H&HD$H|$(E1E1HD$E1E1IH{D$E1E1E1E1H|$1ɺrHD$(H~HD$(E1E1L=RHD$GLHDD$tE11E1LE1L胯H=6H51D$2HT$`H=u6H51LE1llH=P6H5-1H=蔢IHE1E1L=~E1HD$HD$0LLD$ E1膺H=5H511H=55LD$ H LH5Z51H=MܡHHD$ H=51LD$ E1H5ҁL=}1fLD$ VE1L=}HT$XHD$ 1E1H=75H5bL=}tLD$ E1E1L=m}E1E1L=[}HD$E1E1L=@}HD$E1E1L=%}HD$0HT$hH=4H5"~1,IHtPHD$HLH]HD$HHL脳HD$RE1HD$E1E1L/H|$L蝸H5w1E1'H=3H51-HT$PH=3H5}1RE1H|$E1臬HD$rE1jH|$ H$H$LHE1J6HT$LL71@19Lq]Ht$L߳ALH<D$D$VE1o1LLL H=2H5;E1ff.ATSHHtxHH=2;tIHH5U411HFIHtFH9?2t Hmt)HL[A\fDH531zLhE1HL[A\f.AWAVAUIATUSHH5HdH%(H$1趹HH1ҾkHL$H֣H|$o1Ll$ IGH=P!H5g"HP 1LlHH|$xHH$HרH$H¨H|$`H谨H|$hH螨H|$pH茨@H= H5n1H\$LHBLt$XLl$PBH=y 1H5nHH=T H5n1HD$PDL$ E1IEAH=# LH5 n1L\$ ]L\$ H=H5E1=Lt$XLl$PHD$DT$EH|$LjLl$PtH|$7AHD$PIERD$ Lt$X0ojH=q1H5lBE>H=K1H5U|$KHD$@H="H5l1d1H=LH5S1GE11H=H5S1#~IGHxHD$@H=LH5U1D$ lH=H5k1)E1E1AE1HD$H-d1L+HD$HALt$XLl$PE1H=$H5Al1f`H|$0HHT$0H5TH=14Lt$XLl$PLl$ IGt$LLL$8HxuL\$ LL$8HLL@HHFH=LH5T1L\$8DD$ L\$8DD$ D$H|$L-jH-jLHIHH|$HMn|^IGHx|$HD$@IHQjLH51"H=H5_R1L-iH-iH|$LH IHH|$HM{H=wLH55R1L%,vH|$LLHD$HiH=:LL1H5{3vLt$XLl$PE1H|$0 HH=LH5R1Ll$ /D$ ^Lt$XLl$PE1AH-*bqH=LH5@S1Ll$ D$ H=LH1H52Lt$XLl$P:Ll$ H|$x(|$nH i8H51H=2PAUATIUSHtg1ɾrϷHHcztWHji =HnHcH>@1ɺrgHH111H]IMt+HmHL[]A\A]H=g1rH=CE1蛐MtH=/LH5h1n@HhtHhH"HDH5H=R1qH5 HtH L-(h@HsHHOCtL1gqD1?fHh1HIHhaHnUHצIH{=Hw1Hn%Hgf.AVIAUIATUHSugH1ҾHIHHtZLLLHHѳHt|xxu&H=H5HQHXIHu[L]A\A]A^@1ҾH,IHuH==HL1H5PyH=H5P][L]A\A]A^ÐAVAUATAUHHH?-AH1AŅAH52GIHL螞IHuB8芍H=cHHIH5OP1H=A蜍LdHL]A\A]A^DEHDH1]wA\A]A^ɳfH5Z蒳IHtVJ E18H=HHPIH5O1H=HL]A\A]A^~E18蕌H=nHHIH5ZO1H=L觌Df.AUAATIsU1HdH%(HD$1HH$$DLHHt?H$HHpxH$HAH;t'H=LH5N1H=E1HaHD$dH+%(u(HD]A\A]@H=YH5d1@AW1AVAUATUHSHdH%(H$1Ld$Lft HD$Hu0H$dH+%(HĨ[]A\A]A^A_L4L-LL)IHLHHLd$1H|$LHtz1E1IcD$ HH諌9HLpA<-<+D$ II4$Ht}MIwIHtcLuIGHI#E|$ IEtaI GIEH9vH5WHgD$ H[]A\A]A^A_@D$ fDD$ I\fIWHH!IEHtgHHHNH=t9HHtu H HH1Hf1ff.fAWAVIAUATUSHdH%(H$1HDŽ$HD$xHD$pIHtL-͢LE1LH`nD$\HD$HHD$D$TD$XD$ D$(D$PHD$@HD$8HD$0HD$@Džtu  |wHcH>DH= 11HT$xLtD$ D$(D$P证DžufHc  H 1҉T$LHD$`I:HL$htLHH8uT$Lt$xH$MHD$0H D$8H D$@HT$HH= 1E1H5EZD$H-+fD$~*@ND @fD/qLzt_D$X[D$ KD$(;IH[f.HT$HH=$ H5 1fD$Lt$xE1H$H-'LLH迊L跊H|$HzL財H|$8H$dH+%( D$HĘ[]A\A]A^A_Hq HD$@gHY HD$8OHA HD$07H=) 1ҾbHD$HD$Lt$xE1H$H-0LHAXE1&H=H5pC1!@DA1HpLHAŅH=3H5\>1uIHRH5>1[[D]A\A]A^H=H5>E12DH=H5*>E1ff.fAVAAUIATIUHH5RSHDu[1]A\A]A^H5QLtAD[LHL]A\A]A^AWAVAUAATIUSHhdH%(H$X1DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$HDŽ$OHHCHH5E1E1HjLDHE1HE1cD$HUHD$HDŽ$DŽ$DŽ$HD$xDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$|DŽ$8DŽ$<DŽ$DŽ$@DŽ$DDŽ$HDŽ$`DŽ$DŽ$LDŽ$4DŽ$DŽ$DŽ$xDŽ$tDŽ$pDŽ$lDŽ$(DŽ$hDŽ$dDŽ$0DŽ$,DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$XHD$ HDŽ$ HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$PHD$@HDŽ$HDŽ$HD$PHD$HHD$8HD$0HDŽ$HD$DŽ$HD$(ttOF|GwHcH>HH$PDŽ$tuD1y HT$H5H=f1E1HD$1E1E1HD$@HD$ HD$HD$hHD$pHD$`HD$XH=`tD$H|$X>LvHH|$hH|$H|$@ H~H|$ }H|$`dL\H|$pRH|$HxH|$PnH|$ԧH|$(jH- {H|$0HH|$8HH|$xMtLw_HLHH$XdH+%(-D$Hh[]A\A]A^A_fD=DA=@#@^D$E1=FH~AD$H$DHD$xE11E1HD$E1HD$@HD$ HD$PHD$HHD$8HD$0HD$HD$hHD$pHD$`HD$XHD$(fHH$@DŽ$DŽ$(H$H=^f.HYH$|@HAH$d@H)H$L@AG$A5DH$kH$[H=H$]Qf.H$L-@HH$@HqH$@H|$(0H5M1薩HD$(HhL5)T@HHD$?HHD$@'H=YE11vD$HD$1E1E1HD$@HD$ HD$HD$hHD$pHD$`HD$X@AD$AD$AG$hAmDAGA$D$L@AG$dA5DAD$AD$H=H$HDŽ$Ph?H$D$H$H|$0 H=u1^HH H|$0訆DŽ$H|$8 H=-1HH H|$8`DŽ$rH5HwH$H![LVH=H5pH|$X蠚H|$XHDŽ$H5N{# HDŽ$fH=Y|AG$4A]DAG$LAEDAG$`A-DAG$HADAG$DADDŽ$DŽ$AG$xADAD$AD$H5QH$tlH5H=>H5g2fDŽ$@@HH$,@H=1ҾOHD$x DŽ$<DŽ$HH$@HH$@H|$PtH5mH|$P賃fDH|$H,H5=H|$H胃[fDH= 1蝥$-HT$H5٦@L% @HH$ @HH$@HHD$ HH$X@AD$|AG$lA}DAG$,AeDAG$0AMDDŽ$8AD$8AG$pADAG$tATaH$Ht1H`T$H$tH$t$$H$tH=:H5c1|MtL1}WIH]HH5HH|$ "$$B$($H$HLD$x$L1L wHD$`H H|$@H^LD$x$11L BwHD$pH] $tH|$ HD$@H $HD$XF!MLH+<^IHoH|$Lt$hH$MH$@H$ H$ 1|HD$XHfH$ L$11E11ALpH\$XLH1LHH${v$(gH|$  HT$P$H @H|$ HD$@H HH5>1IH HT$PH|$@H H=H5211H|$@)H=H5yHc|$!L$L $ H5 H=!]HH Lt$(M  H|$@ $t't$X Ht$@Hz H|$i DŽ$Ht$D$HG$ HD$`H D$pH|$@tH|$@轫HHsMo$LLLdkHD$ H/$H$X1ɾw IHH$PHtHHj$` $H 1H|$0tuH$H5&H$H$HDŽ$H5vnvVH$LhH$IH5*L1HLH5D-4H\H$LHYH5e*L LH5,H8H$HLHZcH$L茟NHyHH$Z$H$H5,GIHHVLDŽ$HLHcHL)H9(0H@,t@uHpH9t$H̓$Hc$H5+HIH LJV1LHLHcHL)H9.8H@,t@uHxH9tHc@I H1L$E1L$AH$$AD9$H$D踄HIUHuxHHtH5Ht1LLht/H9$~I4H׊uMuIHuL$H$$L$?H\HH5yeL1蔩&H=81E1E1H5*E1qL rLH5)aH5)LawH=H51HL譟iH$L1E1H54*E1sE1E1hE1`HٝH<H5m)L1E1裨jDH5s)L1荨DHݥH r)LLAH5:)1_AEH58)L1;A蒏A9DQHI&sLA+1DHI[H H&LL$H5(1٧D$AEH5(L1譧L$H5lL7HDŽ$H$H5FLDH58(L1R1HHHtpH57L1*9$4H AIE1#DLAiH5o7LH1LUA9|LtbH5u'L輂NHbLL$H$$L$UtYE11L1L荝H5X'L1WH5L1AH5,'L1+H$H5LHgIHb1HIH$Ho1L eIHL虃LLLF\H5#L臁H5$&L1qHًLHއH5#L1MHrH5 _LHaHH$1H$HcHRtIH=H5HD$LL$H$L$譂\L$H$L$?HD$1LH$H$uS~$LlH|$Xt3L$Ht$XLfHL$H|$XLH$`tgHL$HH$Ht$`H|$ooy$u#$dHt$LH4$E1퉄$H$H=UH56E1薣5$5H|$hHt$hHzQH$E11HH$AHH$MQcIHt$1HHHH$ZL$u5H=1LD$E1H5usآH|$nHD$d@LoL$LL$_H$$'$H$pHHkP$AHH$H$)H=H5|E1HD$HD$`HtJL$LD$HHH$H|$Lm^H=eH5.詡"HD$H=?H5E1耡-Ht$L1H:HL.LqH L)HLAH5H$LLD$(CLD$(H$HH$H$HLHL$(aH$HL$(HHt$(.srl@H|$`t)PHt$`H[$]$tH|$(H$H=H51TH LH5H==LKHH=11E1H5E1HD$HD$@HD$ HD$HD$hzql ZH=kH5|1譟@H5H=J11葟HD$HD$ H H5 H=HD1ZHD$1E1E1HD$ HD$@Ht$ HD$E1E1HD$@HD$ k6&H=H5X1ٞ HD$@1oH=jH5c1謞H$H=HH5E1艞HD$H$1]H$H=H5ILFv 1tDwff.@W1Ð1f=DH)@uwH>HcH>H($HH$H#H#H#H#H#H#H#HcH#H#H#Ht#H}H!UHH=AVHtH]]fATIHUHHwEtLKIHtHޛvFH=5HtHHL]A\fDHHL>H]A\ÐLHHHtff.ATIHUHHDtLHHtH>v&H=?JkHt#HHL]A\fDLhHH8tH]A\DUHH=l\HtH]]fATIUHH HHH"HDMu HtL`HLH1]A\J=f.HtGATL%!UHHH?^H}L<SLH=SH]A\øf.AUATUSHH5!HHdH%(H$1XLc:L CHH{:txuTE11L-!aLLRH萖1H$dH+%(H[]A\A]fHLHL)L- HpNHSH}ZLHIHtDHt?/L1Ht(HL`bE1L-F 91KjH$ff.AUATUSHHGt0CE11HOLOH1[]A\A]H?IIJ5tCH;1t? CHHE1>AHtH[]A\A]fDHsLLFH;HŋCHuuHsLL蘀H;I蝊CMtuHtEH.@HPHHt+;puL/~HH LMdHLQxdH6H?gIHLRff.AWAVAUATAHUHSHPHIPHM=bAƅt&Et!+pH!6HcH>DH=1DH5PM=XAtL=AL`H=L1H,H=H5ZoEpHcNH=H5mH1גbx D95 bE1aAƃ+wzH5HcH>EMtXH=1H5Aon=tL%oLw\H=L1HC+H=H50nEu:HD[]A\A]A^A_fEuAuAauHW/auH=DH51ϑDH=qH5;m`+w)H5HcH>D5`EfDE1EMtAH=H5h1VL~H=HOH=H51*EfMtH=H5 1L@E 3`HVE1EMuE1EMPE1M"zD~B?~H@u>@tXu)H.tH~H+t_fttuHfDHLHHHHjAUAI͉AT1EH UHLHHHHt[p9uEH|EAHOHH5;8HD1`DLH:H1]1A\ A]2@H 8.ff.@AWIAVAUIATIUSHDt$P `HIcHD$HtKEFH|$X:HD$XHMLLH57LAQ=f.EH|$XHD$XHMLLH5J7LAQH1C_AXLHD$XH8HD$H[]A\A]A^A_f.uE~sID$ H8tE1L->7fDI\$HLLH1II$ILCH APM跍XH3HZSW8ID$ L90wjI|$VI$EL@H @EMLLH56H1S fDEID$ E1L-(6H8fDI\$HLLH1II$ILCH APMYSH^H37ID$ L90wEMLLH55H1賌fDI|$nI$EL@Hff.ATL%aUSu L%THXLD@ui@tQHIL%=LDu4HpH=ļI[HL]1H5A\ftt/xE[]A\[?LH5HH=w[1]A\鼋@3?LH5H@?LH5Hff.AWAVIAUATUHSHH(D%ndH%(HD$1HD$Eu#H=4Op_-HE1"RL=HT$1L$qAą9H|$L5^H5WfD$HD$L`LLd$ރHH\D$Hu1LAfEpAVL |1hE1H  1SH5%t$(UjTH0HHﺆH5BL<)HD$dH+%(H(D[]A\A]A^A_fD_IHHMfL1Ҿ.H,DH=qH5b31賉념H=YH51蛉L(bfDH=1H5J3E1r%DH=H51E1PYH LH51H=&uH5H=*jf.SHHdH%(HD$1HH$TtH$HT$dH+%(uH[Yff.@AUATUH`dH%(HD$XuHT$XdH+%(uHH`]A\A]ÐLl$HILHT$t1L;d$uLHL 4Xff.ATUSH`dH%(HD$XuHT$XdH+%(uGH`[]A\Ld$HLHT$9tɉ1H;T$uHL3XAWAVAUATUSHHH|$}H`HH[HHuD$L5L-L%HM8HU0Hu(H|$D$D|$mH=H5 1D1A=tL=H}(wTH=1LHH=lH5bHyHHt3IfDLA#GH=8IEL1IvIHuH=H571YH|$11Ҿc/H5fHH=ӶHDbu%HmPHH[]A\A]A^A_@Hu(H|$Rzt;Hu0H|$>t)E@uUHM8HtH|$X/Hu1H[]A\A]A^A_fH=9H5d1{\fDH|$11Ҿi.H?1UHH5ζSXHa~HHtrH{H1HHHCPH)XHHEH]HCHHt PSHXPH[]fDCH[]H XH51H=v!hAWEAVAAUATAULSH0dH%(HD$ 1H\$hSSZYAŃu {H;H56 6`HHtHHPHHtD;`uAA A t]AtW1A HİH[HfHPHH?D;xuH;H5 1蘃EH8H;HLHDH51jHD$dH+%(H(D[]A\A]A^A_@D1ɀ=HPH;1H55 L$ H$DH$L$ f1==wN=S=uDYHH.H;^H;DH5! 1謂=uHt.@VQH;H{^fH0 NHHHHHD$+111ILD$15HbRHT$H;H5D 1 EDD}EH;AAH4H5 1ցHHtZHHPHHtCD9xuH;H5$ 1蜁H8PH;H}]UH UHNuHuHHHHt;PuHHHDHPHH;puH;HtxH58 1/D}EH;AADf1=D}EH;AADH5*1蟀DbOHH;DH5 1vH;H5 1`PfDATIUHdH%(HD$1}1LH@3?w HH(T$Ht$HO11Ҿ H"HD$dH+%(u H]A\0PAWAVAUATIUSHHwHtoLHIHt\H{ut{tnHLA-vHu<{uSL?Q=H=H51/E1HD[]A\A]A^A_f.H=H51~H=H51~H=H;H=H5j1~H=kL:H=\H51~f5IWIWHMtSH"ucHO\LG\Laf.H=H5(-~H\L\19a1LH-uMHL~8o1LLY-AŃVHt}MHLLHe5H/` HH =H߅ \[LT[L`+H?[18[Lp`1@ATUHSHHHCHHHHHPHp LH(L@@xLHCHE1H5s'H=HH(1|H{P#HCHD[]A\fEPAȐH~R1H=+H57AHH1c|밐H= H5*AG|yfAWAVAAUATIUHHSH8T$dH%(HD$(1cEBHE1E11j11LD$A[A]u,HD$(dH+%(H8[]A\A]A^A_fH5HWH5HWD$EHD$1L|$HD$Lt$ Ll$$f|$lHLMt$E1LL6Y^tH5H!WD$T$ - wHHcH>|$$GHHkHH51z|$ lfD;$LHD$(dH+%(H8HH5[]A\A]A^A_{VH5HiVH5HQVH5H9V|@H5hH!Vd@H5=H VL@H5HU4@HLME1t$LLeXZHE1E11j1ҾLeD$AYAZH5{H|UT$HH51Zy|$ t"HH5HH19y|@T$H5H1y]IAWAVAUATIUHSHHcHI'L-H5S H1E1xHLH+H1H5xHsH5oH1xALw'A9DLRHH8)HIVH5HA19xEpDpHH5Z6H1xHrpE1!DHA%HHޔHrA9|I@H[]A\A]A^A_fH5sHH[]A\A]A^A_wH5>1DHIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H=HLH$$HD$HD$ D$0HD$_HT$dH+%(uH)GfAVH AUATIUS1H@dH%(HD$8HB2HL$IH$H_HD$HD$HHD$ HSHD$(HHMt-L!LLH"tHHHuHD$8dH+%(ugH@LH5P1[H= ]A\A]A^jf.HD$8dH+%(u)HL,H@L1[H5 H={ ]A\A]A^'FfAVAUATUSHH5IhVLH/IHuhH YE11LAH5'tcL ftUL+H=ƥH5H1u[L]A\A]A^fH E11L"zfL+H=qH5#H1tH=YLE1p[L]A\A]A^DE1[]LA\A]A^fH=H5pE1ZteJ[L]A\A]A^fH=e.IHtD1LH5THH#t$11H5EL1#t MDLpH=LH51sH=yff.@AVAUATUHHHHG*HIHI|H5MlLlIHt@LH5H]LLLLH5LLHLHL]A\A]A^ÐH=H521E1rHL]A\A]A^fH=yH51E1rfDATAUHS~21@H9~|tH~T9|?H53H*cDGAWAVAUIATIUSH8L$L$t@)$)$)$)$)$)$)$)$ dH%(HD$x1H$p$ HD$H$D$0HD$9=ZL|$ HaLPLIH/1`L1ҾOLH5LP>HLHHYH5kH1q11Ҿ HLe_L=HD$xdH+%(urH8[]A\A]A^A_\. o$HT$ LIHD$LD$ HD$0[YLH51zpL@fDAWALAVILAUI1ATMULSHHdH%(H$1oEIIAH LHKH`HD11C_=v,H$dH+%(H[]A\A]A^A_Ð=a6 L Ht$AMH 8LE)11MH %L11LL1H5)d=o~LLH1YK11Ҿ L2y?fAWAVAUATIUHHSHLAjAu\1L5L=^fLIH…tHD$LH1nHT$LH1xnA9AH[]A\A]A^A_fDHHH5'1[]A\A]A^A_9nfH5H1nQf.SHsH4 D>/t;HHH9rL0L9tLǺ'IL8[HATUSHH:HWH>H5ŝHHTHH5!H9AHA t|L%a1E1L!H=!L ! DHtCL9H9u&L9t!8uMtLH5fH=11[]A\ÐtRH5LtBH5LLt/H5LLtH5.LLA1Eu_E닐@EoD@@EODGE 0fD@ƀE DWH5]KtwH5LKtdH5-LH=1LH55HH-%L%@HuHHHcEHtL1fEiH5,BKH5 L+KH5$,LKH5LJH5RLJt=H5LJt*H5LJtH5LJH5LH={1H5HH-L%HuHHHcEHtL1fDoE(fD@ nEDEfD@NEDH=1:[1]A\HH51H=}H5HtH-L%@HuHHtHcEHtL1fDHH51H=H5H`H-L%4HuHH7HcEHtL1lf.HH5&1H=HH51HH-!L%HuHHHcEHtL1f.HH51H==H5HH-L%THuHHWHcEHtL1f.HH5F1H=hH5QHH-AL%HuHHHcEHtL1f.HH5֖1H=]H5HH-щL%tHuHHwHcEHtL1f.HH5f1H=H5qH0H-aL%HuHHHcEHtL1Ht2HDH{HHtL[Bu[]A\DH5H=S1HuHHtH1HHuHu[1]A\fAUATIUHSHdH%(HD$11HHD(HAH$:u=H9t8HHHv;"t I$DHutDH1D+HT$dH+%(u H[]A\A]0ff.AUATAHL-אdH%(HD$1HL tH$HcAH9u!HD$dH+%(u+HDA\A]DLH5.H=21P90fAUATIUHSHdH%(HD$11HHD(H,H$:u=H9t8HHHv;"t I$DHutDH1D+HT$dH+%(u H[]A\A]{/ff.AUATUHdH%(HD$1H$HO+OwHHHcH>AfHD$dH+%()HD]A\A]@HAUCH=1 m?ƅxHA9 HA CxHABXHAB8HABHABHAmBHAMB@HA-BHA Bx HAAXHAA8 HAAHAAHAmAHAMAHA-A HA AxHA@XHA@8H5YHE1.HAH591HE10AH51HE1 YAH=HAąH4$HA-H=1 E<ƅsHAmKhH=tHHHA D5DH=YD+Dž:H%H3AąH!H5ʊH={1H=1OIHHHAąL(%HH5j1H=wHH5I1E1H=ZhSH|H5%1E1H=ND/HXH51E1H= H5oH=:H5WH=:H5?H=s:)ff.AWAVAUATUSHH-ddH%(H$1HcBHH<HHDH|$Ht8-t0E1H$dH+%(SHD[]A\A]A^A_ÐS߈8-u x-x-Lx=LHCHHHH L5xM.ME'AhuEgEuH5=L9tLL 9u~AF H tW-tRHPуFwJH zHcH>x9LxH9HUQH?EffDMnIMJHHRH HL=D`z&ctAw HbH4H=LJHT$nIHAH5PH=tL-Ht$(ALHD$(HcЉD$H9!AV pNIH)H5҆1H=LH51AH=h0H-ن1Ht$(D HH.HT$(:H9H5Hu D#?H=Ht$ &A@H=YHt$0/H@H51AH=KfH=Ht$(_DKH-1Ht$(D HHYHT$(:HpD#A5fHL$HT HH%D$H%=@-(;"땅IHKH51H=LH5քH=g'1$HM1AH5H=0iLH51AH=HLH5kH=1;HH51Hc"HH Ht.9t)HttH<HL>Ht9u8HHtH5H=11Hf.H5ɃH=11HHtH5H=11HH5~H=211afAWAVAUATUSHHL?dH%(HD$x1M IL-Lf.L9t+&A~ D`-tԴH EdD9ALI~IHuø9NʼnD$HHD$I9E1DLsHI9ǸDDMHZLDL;|$&HI9HI9 fopHD$ D$pHD$H)D$ )D$0)D$@)D$P)D$`I9EHH5 HDL-1LH-wH3HAǸDN>HHD1{ Aǃ-t芳LH1NANjL$9ND9D)HD Ht$L1H=L{HMHD$xdH+%(3HĈ[]A\A]A^A_D$L%H=1L0L;HeI9LH=1 L;HHD$My{ A-H5H1D$p D$fo )D$ )D$0)D$@)D$P)D$`H=\1H5KL1q@H=F1ZDHcD$fDH<HD$O f.AUATUSHHtiHIHE<.H5~hLHv~RHj=AąHt!XHٺHH5HtxEuLAHD[]A\A]H5H=1E1NH=HD[]A\A]fD1H۾iH1H-HuH5AH=ZE1NH=KsH=9H5*i1{NXfDHtWUH-SHHH{(GH{0H{8HH[HHGHuH[]Dff.@ATUSH/HIH}HHu_@uL E111HE0H}H} Ht1HU8Lx1t\HmHHtcH}HtquI1ɺHE(Ht/H}HuH}uL 1E11\HE0Hu1[]A\f[]A\fDH}HtH=}H51L[1]A\HuI$fDATUHSHdH%(HD$HH$HYH7HcH>1HT$dH+%(H[]A\ÐH$HPH=|DL$$I|$H=|Hj|H51 LH=|LHE1kfH$HxtH}H$HZ|HEHP*H$@@ H$'L$$I|$ t\H=|H{H5x1PK?HtLH$HEH{ID$fH{ID$ |f.H={H2{H5JL$$DH=q{H {H51JL$$ff.AWAVAUATIUHSHHdH%(HD$81HD$ HuuH*H5LI19JMtLH5L1 J1HT$ HCyMHD$8dH+%(^HH[]A\A]A^A_f.HH5fLH1IfLD$0HL$HHD$0HT$Ht$HD$(LL$(LD$(AI HD$0H5zJ\BIHHHwHH fDHHBCBH9uGH|$( HPL$LL T$H5LFH1AVDD$-HXHZHH5L1HH5LDO<H\$0MOM9LϺH5yLD$L $AL $LD$HIMK4>LH fHHBCBH9uDH|$ HtDH5L1GEHH HDfLH=?xLHw1H5TwGH L1L$H5wH=Ϗ*L$H=H 1H5uw1fAVIAUATUHHS1:2fHV!sHIH!LLHI ~3H9|L\Aąt]A[]DA\A]A^MHLH=,wLDH51LE1dFH= wh[D]A\A]A^@H=vH5I5"H=v9[D]A\A]A^ff.fAUAATUHS1H?IHS LH1H9|EuH[]A\A]LH5!H[]A\A]ÐAWHIAVAUMATUSHHH L$Ld$X1HtHHxHHE131fDLHH1L9|HjL_ H~D$`H$L  E1H|$Pt>I1Mt/Ht$PLA3tLkL HH$4L,$H[]A\A]A^A_f.Ht$IHHtkMLT$t!LHLT$E14tLT$MtLHE1"{H@H5!HY@E11GfDIHtMtLHS4H<$tH4$LH|$P1E1ff.UHsH5#HHH5H#HH5]fATIUHHH=sHHtSMtNLH5c_HHHtp11Ҿt.HH5do)H1]A\D1H]A\fDH=9H5]H=&11Ҿ (fDH=rLH5W1(B룐AVAUIATIHUS)HbLHyHEIHtHHu#L)[]A\A]A^f.LH5^L1A1L-D=sAtL5sHL1LH]LLHE9|[]A\A]A^[L]LH5A\1A]A^A@ATIHUHHuHk=D1H1ɾLCH LH5HHHDH1]A\@fDHLH51]A\@AWAVAH5AUAATE1UHSHdH%(HD$1D@~AAEu]H5yH1E1@ HA11E!HD$dH+%(XHD[]A\A]A^A_f$H50H1?A!{kH$IHto1HD6unH<$E1E1H5H1E1[?L53LL LLW1E1&@H<$3H<$IH<$IMmMd:L6LLHHH5HHE1E1>A8ff.AVHAUIATAHUSH(H@dH%(HD$81Lt$L-ExAdD%bHx.HHlgH_.IHvH\=H1ɺLH1LvLHHvLf11ҾeLUH1HL$ iL8t$ H=mHD$8dH+%(H@L[]A\A]A^fL1LH H=mLE1gH DEH 7L1E1glfE1IH L118fDL1L H *[ @SHH x [f.H&[f. v[fDAWIAVAAUIATUSHH=mHIWH59HHIHE11ɺH/LH LLAAHm7ÅAL5L`4IHyHHLAUAAH?XZyfE111ҾHl.tfHÅxڹLL.LAH LLHD[]A\A]A^A_E1L5CyLL.t8u"H=jH5;1>:LE1fH=jH51 :H=jLE1@f.E1FH=yjH51E19H H=TjH 1H59H=3j@ATSHH5jH(dH%(HD$1l2IHtH1HLH$H2HD$$x(HAHD$dH+%(u?H(L[A\fDH=iH518LE1rH5<% H H5h1H=t[ff.@HHL dH%(H$1HHHuT$tHfTHuA<HuDI@HHH< HttHH$dH+%(uLHÐL6fDAUIATLcUHSHdH%(HD$1H$|H HHDEu;H$H9t:u HxL9|+HD$dH+%(u$HD[]A\A]fE1AEAAVAUATUSH`dH%(HD$XHHt$HD$HX~Hl$H3AąrsLl$uCWNsE11IHHHc4L,.sAt=s%D9E1HL=,HD$XdH+%(H`D[]A\A]A^fIHD%rEtE1Lt$OfrH#HLHcd2tQ@LLt=frAM=Cr%D931HLCuA@E1AA fAUATUSHhdH%(HD$XHD%qHhH0EtyE1Ll$Y111H-t~qH1HHHc"t^Ht$@LHytEoqAt=Pq%D9HD$XdH+%(uHhD[]A\A]AUHH=AqH5%qH=&qH"qHtHP(HH5S1]4HH5J1]3ff.AWIAVAAUIATEUHSLH5oH=gd11Ҿ HLD$@HHH ܱH=%dHH51d3< <.!HHcHT: PIA9%Ex D9H[]A\A]A^A_H=cDH512nuVHuQH=zcLL1H52 nu;H`HH"fD1H[]A\A]A^A_ fMt=A}t6LD$HLHH }fD{ H[]A\A]A^A_f.H=bDH511H=bH5R111F@AWAVAUEATIULSHHxdH%(H$h1D$E~AFI҃HAAAA EIEI:L LDL$OA1EtL$Mt+1H5 H HH?I9uHBLMH=vEAƄ$AA_AF LL+HD$A HD$@HD$HH$H5fLH4$L|$nLt$pLHLLL- L}L|HHD$ F|LHqL|HaD$,A|LHCHL|$ ML9z%IHiHt$1HJHT$LL,2LLL+IHBHt$1HHD$0LD$0!HT$LL+LD$0LLL+LD$0L|$LLLg+LD$0H$1LLD$8HHD$0LD$8HD$L9SLd$@MIH\$0Hl$HHfDI)L9uHHL*uLD$8Ld$@E1E1Hl$HL=d AAAHHLH5HDGEH‹$$uXtIHLH56H1-H$hdH+%(Hx[]A\A]A^A_@$t t L@H5޽H1W-HH5LDHRfD Ht$`I}-HL$`1Ҁ9$)D$,ɚ;LiH=ɚ;L|$nH4$Lt$pLH(LLsL-L$L|HHD$ (L|HL|HL$,P1L$HμL|LHL|HAhE1E1L=YE1LL $ "L"H<$LsLLcL1T1DH=q\H51+fHD$ HD$HliH$DIxLT$H5\D\$LD$H<$$H<$LD$HD\$LT$I>M L fDE1E1E1E1L=KH=CЉT$,E1E1L="Ht$0LMLLHl$HLd$@_'LD$8tHLD$8LL|$IHT$LH1'ItAtHT$Ht$0LD$8IHt$01LLD$8LD$8XHt$1LLD$8LD$87HD$IHt[H\$8LItCHT$LH&uIE1L=(E1LD$8IE1E1L= IH\$8H$ 1LLD$@HHD$8LD$@H|$LD$@L=LLD$@HIHt$HD$H9H|$8LAL7Ht$8HzHHH IJJLHH)H)L$HH|$H)HH9rHt$8H1Ht$LLL$HLD$@_LD$@LL$H3$H\$PLL|$@ILHHD$HHT$ LH9%UHl$HuIHt$81Hl$XLH\$PLL|$@LD$@LD$@LL$XH|$ LLL$PLD$@LL$PHI H1Ht$8L$ Ll$8MHl$@HH\$XLHT$Ht$0H$oH1HHnH1HH+H|$PHT$LH2$Ht$01HD$,HH9<Ht$1HHHD$PFHT$LCL|$Ht$0LLD$8L#LD$8MBcHD$HH HH5-WH=Vo1D\$L$LT$LL$D\$L$}1HD$LE1zHT$Ht$0HT$LH#MHl$@Ll$8I>HT$ LH"zIILE1L|$@ILl$Ll$8LH\$XHl$@LH|$LmLL]HEHH$$5j6$$H5O $  1ɉ?<>@|HHu$$  $ 1ɉ?<>@|HHu$ $ $ 1ɉ?<>@| HHu$$ $  1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$$ $ 1ɉ?<>@|)HHu$$ $ 1ɉ?<>@|-HHu$$ $ 1ɉ?<>@|1HHu$$ $ 1ɉ?<>@|5HHu$$ $ 1ɉ?<>@|9HHu$$ $ 1ɉ?<>@|=HHu$$ $ 1ɉ?<>@|AHHu$$ $ 1ɉ?<>@|EHHu$$ $ 1ɉ?<>@|IHHu$$ $ 1ɉ?<>@|MHHu$$ $  HL$H?<>@|QHHu$HH? HUHHWPV$$H5 $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$HL$H?<>@|)HHuHH,HE1E1E1E1tff.AWIAVL5AULATUSHH54HH=MdH%(H$10H HHl${CH=HcH>f.D$ LL-f.1HHL$ L$HALdI)1LHLL ~HII)NjD$ {HKH>HCLL1 HcH=LLILH5CLO1H(A$H HH$dH+%(.H[]A\A]A^A_D$ LgL-DD$ L[MfD$ L'MfD$ LL-!DD$ L߫MyfD$ LMYfHLL1l AIXfK1HʫLL9 fHII)Y/ff.@AWIHAVAUIATUHSH8dH%(H$(1wD$cLd$ 2fLH5sH1<HA9\$L:HI}HIM)AIcҹLLLT$HD$ LD$1LLT$LIPBD [LH5H19\$cH$(dH+%(H8[]A\A]A^A_Ð11LLH$(dH+%(uAH5H8H1[]A\A]A^A_ H$(dH+%(u H5.WATIUHSH dH%(HD$1D$ HD$H|$HF H|$Hy HuMuOH|$t_B1HtH|$ IE1111D$ HT$dH+%(u2H []A\HL`H1zf.Ht!0>wH@@@@HAVIAUAATUSHHdH%(H$1HHH5\L!IHt 1MMtrHHLw1HIHLHH$dH+%(HL[]A\A]A^EZ%IHtMHHuH=wGLH5=LH=YGE1豽c@E1H=9GH51{fH=GLH5ZLfDH=FH51+vAVAUATUHHdH%(H$1c=L5AIH1LRLL1HL$L;WLLLHPywt HL,AExWH$dH+%(H]A\A]A^fH=EH5q1H=E1H=EHL1H5.H=EGHL@H=yELH1H5H= GIfAWAVAUATIUSHHdH%(H$1ݿ=L$L1HHLL$L5RLLL QHj1lHLLPHV1LHLHHHsHYHInE~fLLNHHHiFH5 HH8HHD1{H#'@H=DH51SH=CW1H$dH+%(u_H[]A\A]A^A_LH=CL1H5gfDLH=CL1H5?>ff.AWAVAUATUHSHdH%(H$1=L$H1IL%£H,LL$H$LHLSL1LHLOH1oH1L$LSHRLGL1LNHH/'LH|y裪t HLXLLEyQltEt@H=BLL1H5UH=CLHHL^LHAEH$dH+%(H[]A\A]A^A_H=AH5)1H=|A׷1H=iAHL1H5H=B9HLN@H=1ALH1H5mH=BH=ALH1H5~=H=BLLff.AWL=lAAVAUATUSHLH(Ht$LHT$ HL$ HH,H,H$IHt(I,LH$Ht HH$HIHHLUAƅME1H5@DHɢJ4LDAƅt3II uH=?L1E1H5E1BfAA E1vqHD$AD(HD$E1L LHK 'LH(D[]A\A]A^A_DAH=)?H51E1hfDH<$IHH4$HAƅA AEAHE1A2fH<$trH<$1~IHHD$E1L(A@H=q>H1E1H5> H$H=M>1MH5 H=0>H5!1E1o H=>H5<1E1R H==H51E15 yH$H==H51 [H==1E1E1H5 ;fAWAVAUATUSHH(?/t$HT$rtIHL{H56>Lp HH CE1ZLl$I<=DLIIAEAt<=uAEH2AGIWHLI L9u纐LHH|$ MH|$CL[H$HdH+%(HXD[]A\A]A^A_H=2H51E1AHD$L=e3HD$ L$6Ds2ED$EH562H=72IH;HH|$XHHHD$EHt$LwH|$`H5v>H\$xH5hH"$E1HLHt$`0-Ht4L+11H$HtHc$H$Ht$LOH|$(LH蕵2$n H$E11LHAL-Ht$HHïHt$HLƺ H|$@ H-0H $H HHqHT$@LHH=w0ڵ $Ht$(L.[ $uhH|$A+HHuX fDHDn,H褥0DHƅyLHH 3L11HߺH$8HHH|$XQL={0H=.LHH$(H/H$8?HD$PL$HxLHHH=N/H$8H51H=1/H51sHEHDDLH|$IHLH=HHHDLLEAƅyAtqyH$L$LχH$Ht H$L@H$H HtHHIWH=+H5[14eL$1E11H=+H5ӰL$IWL=a,>HD$PLHxHHtCH=y+H$(H5B1H=\+H5e1H$QH=(+H5i1jLH$ H=+HH$H=*1H5x'$ugH=*H5g1H=*11ɾ ӜHl'H$Ƅ$H$6虊@AW1AVAUATUHHoSHdH%(HD$1HH5HA1]L=L5L-Ɓ7fDLH1+H$A9t8H5z,HH$tSuLHH$A9uH52kHHD$dH+%(u;H[]A\A]A^A_LHuH5ޡHaAWAVAUATUHSH8dH%(HD$(16HI[HHD$H=H5H1&H6HnH趺H=H5ȀH1H=1HoMDH=}H5A=tL%LCH=L1LH菄H=8H5i|1HL$HlؔH?1HL$ H軔HH5H裠H=HtHH=HUHD$(dH+%(H8[]A\A]A^A_f11ҾnH?H1ҾnHL$ H!H=ZH5^IMHt$ H1L5)謞IMtVLH=H]HD$ HHpHt$ I9HjIHtH=L#MuHD$ H=f8uH50DH5HD$ H=H5t1HD$ H=sH5ltP1O@H=QH5gzH|$H=3H5~1o f.H= H3HT$ H=H50~1&|$H=H5}H1f.H5YJH5HqH=g}fAWAVAUATIHUHSH8dH%(HD$(1Ll$ K1HLt$L1lHL!l1LlH近Ht |$N1L龍H蜑Ht?HT$ H5}L1HD$(dH+%(wH8[]A\A]A^A_fDLHtȋ|$0WH5<}LH1f.L1ҾgHHÅH5|LDsE1H> fDHD$ LB8MH fL@HMtc;PuMtH5LLD$LD$LLIGM9tbI軵H5>|LH1fMtH5LT$T$H5{L1IGM9uH5dLAUIȉH{ATIUHHdH%(H$1IL=wCH qML1sLH1H511Ҿ HшH$dH+%(u H]A\A]fLHnLE12^H H4DDH蕱LD$MHLL= AHA9|Ļf.uHmLL]HHHImHHLiHlmLHw]H1Ht$LE1E1LٞYH^͌DHD$dH+%(*H([]A\A]A^A_w*H葚H LHlL\HE=H蒩HHH^H5LHmock server received error: pkiStatusInfo absent pkiStatusInfo: %s errorCode absent errorCode: %ld errorDetails absent errorDetails: profile1wrong certificate to revokekurp10crgenm%s: Use -help for summary. Unknown item name %s Supported types: %s Error reading PEM file asn1Can't find 'asn1' in '%s' '%s' is out of range Error parsing structure Can't parse %s type Error: offset out of range Error writing output Error parsing item %s apps/asn1parse.cunspecifiedCAkeyTimeholdInstructionapps/ca.cMemory allocation failure apps/lib/apps.crow exp_datarow ptrfailed to update database TXT_DB error number %ld ERROR:name does not match %s Revoking Certificate %s. Unknown CRL reason %s Invalid object identifier %s revocation reasonrfc_822iso_8601No configuration used Using configuration from %s default_caoid_filestring_maskutf8yesunique_subjectdatabaserow serial#Serial %s not present in db. %s=Valid (%c) %s=Revoked (%c) %s=Expired (%c) %s=Suspended (%c) %s=Unknown (%c). Error verifying serial %s! private_keyError getting password CA certificatepreservemsie_hackname_optInvalid name options: "%s" cert_optcopy_extensionsnew_certs_dir%s: %s is not a directory in entry %d generating index Updating %s ... %s=Expired Malloc failure UNDEFdefault_mdno default digest email_in_dnnomessage digest is %s policy is %s rand_serialx509_extensionsdefault_startdatedefault_enddatedefault_daysnext serial number is 00 next serial number is %s error on line %ld of %s Signature ok template certificateerror unpacking public key CERTIFICATION CANCELED writing new certificates writing %s Database updated crl_extensionscrlnumberdefault_crl_daysdefault_crl_hoursmaking CRL signing CRL no input files certificate to be revokederror setting CRL nextUpdate error setting CRL lastUpdate UNKNOWNOpenSSL cipher name: %s Error in cipher list 0x%02X,0x%02X - %-45s - %s:%s:%d:CMP %s: %s %s%s actually sendingactually usingint:str:trusted TLS certsextra certificates for TLSTLS client private keycertificate to be updatedhttp%s://%s:%s/%s via %suntrusted certificatescerts trusted by clientPBMACextra certificates for CMPPKCS#10 CSRSubject Alternative Namerecipientexpected senderdeletingwriting%s certificateverbosity-%sDisplay this summaryGeneric message options: cmdinfotypeprofilegeninfotemplatekeyspecnewkeynewkeypasscentralkeygennewkeyoutreqextssanssan_nodefaultpoliciespolicy_oidspolicy_oids_criticalpopocsrout_trustedimplicit_confirmdisable_confirmchainoutoldcertrevreasonMessage transfer options: no_proxykeep_alivemsg_timeouttotal_timeoutunless -srvcert is givensrvcertexpect_senderignore_keyusageunprotected_errorsno_cache_extracertssrvcertoutextracertsoutcacertsoutoldwitholdcrlcertoldcrlcrloutown_trustedunprotected_requestsCredentials format options: crlformotherpassProvider options: provider-pathproviderprovparampropqueryRandom state options: writerandTLS connection options: tls_usedtls_certtls_keytls_keypasstls_extratls_trustedtls_hostbatchrepeatreqinreqin_new_tidreqoutreqout_onlyrspinrspoutuse_mock_srvMock server options: max_msgssrv_refsrv_secretsrv_certCertificate of the serversrv_keysrv_keypasssrv_trustedsrv_untrustedref_certrsp_certrsp_keyrsp_keypassrsp_crlrsp_extracertsrsp_capubsrsp_newwithnewrsp_newwitholdrsp_oldwithnewpoll_countcheck_aftergrant_implicitconfpkistatusfailurebitsstatusstringsend_errorsend_unprotectedsend_unprot_erraccept_unprotectedaccept_unprot_erraccept_raverifiedValidation options: certificate chain purposeverify_nameverification policy nameverify_depthchain depth limitauth_levelattimeverification epoch timeverify_hostnameexpected peer hostnameverify_emailexpected peer emailverify_ipexpected peer IP addressignore_criticalissuer_checks(deprecated)crl_checkcrl_check_allcheck full chain revocationpolicy_checkperform rfc5280 policy checksexplicit_policyinhibit_anyinhibit_mapx509_strictextended_crlenable extended CRL featuresuse_deltasuse delta CRLspolicy_printcheck_ss_sigcheck root CA self-signaturestrusted_firstsuiteB_128_onlySuite B 128-bit-only modesuiteB_128suiteB_192Suite B 192-bit-only modepartial_chainno_alt_chainsno_check_timeallow_proxy_certsUsage: %s [options] [cipher] General options: Even more verbosestdnameShow standard cipher namesconvertOnly supported ciphersCiphers compatible with TLS1pskciphersuiteskeyCompromiseCACompromiseaffiliationChangedsupersededcessationOfOperationcertificateHoldremoveFromCRLcompatibleca_defaultno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumpoutdirWhere to put output certThe input cert request(s)informinfilesdateoptnotextDon't ask questionsss_certspkacConfiguration options: A config fileAn alias for -nameThe CA 'policy' to supportCertificate options: subjcreate_serialmultivalue-rdnnot_beforeAn alias for -startdatenot_afterAn alias for -enddateextfilepreserveDNDon't re-order the DNnoemailDNThe CA private keyThe CA certselfsignvfyoptRevocation options: gencrlGenerate a new CRLupdatedbUpdates db for expired certcrlextscrl_reasoncrl_holdcrl_compromisecrl_CA_compromisecrl_lastupdatecrl_nextupdatecrldayscrlhourscrlsecRevoke a cert (given in file)certreqoidfile of extra oid definitionsI/O options: nooutdo not produce any outputoffsetoffset into filelength of section in filestrparsegenstrgenconfstrictpemitemitem to parse and print(-inform will be ignored)Formatting options: indents the outputunknown data in hex formdlimit%s:%s:%d:CMP %s: %s option argument is empty string, resetting option%s%s %s:%s:%d:CMP %s: %s option argument starts with hyphen%s%s %s:%s:%d:CMP %s: unknown cmp command '%s'%s%s %s:%s:%d:CMP %s: no cmp command to execute%s%s%s %s:%s:%d:CMP %s: unknown option given for key loading format%s%s%s %s:%s:%d:CMP %s: unknown option given for certificate storing format%s%s%s %s:%s:%d:CMP %s: unknown option given for CRL storing format%s%s%s variable lookup failed for %s::%s %s: Memory allocation failure Adding Entry with serial number %s to DB for %s %s: Could not allocate %zu bytes for %s ERROR:Already present, serial number %s ERROR:Already revoked, serial number %s Invalid time format %s. Need YYYYMMDDHHMMSSZ Error in revocation arguments Invalid global string mask setting %s Problem with index file: %s (could not load/parse file) CA certificate and CA private key do not match Invalid certificate options: "%s" Invalid extension copy option: "%s" there needs to be defined a directory for new certificate to be placed in entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database No entries found to mark expired Done. %d entries marked as expired Successfully loaded extensions file %s Error checking certificate extensions from extfile section %s Error checking certificate extension config section %s cannot lookup how many days to certify for Warning: -enddate or -not_after option overriding -days option error generating serial number error while loading serial number unable to find 'section' for %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key Check that the request matches the signature Signature verification problems.... Signature did not match the certificate %d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error Write out database with %d new entries certificate file name too long Error checking CRL extension section %s error while loading CRL number cannot lookup how long until the next CRL is issued Error adding CRL extensions from section %s Error setting TLSv1.3 ciphersuites 0x%02X,0x%02X,0x%02X,0x%02X - %s:%s:%d:CMP %s: NULL arg to write_PKIMESSAGE%s%s%s %s:%s:%d:CMP %s: not enough file names provided for writing PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot write PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: not enough file names provided for reading PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot read PKIMessage from file '%s'%s%s %s:%s:%d:CMP %s: cannot write request PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to using mock server%s%s%s %s:%s:%d:CMP %s: missing -server or -use_mock_srv option, or too few -rspin filename arguments%s%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to contacting server%s%s%s %s:%s:%d:CMP %s: failed to load ir/cr/kur file '%s' attempting to get fallback public key%s%s %s:%s:%d:CMP %s: failed to get fallback public key from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: failed to get fallback public key obtained from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: Missing ':' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Invalid OID in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unknown OID in -geninfo arg: %.40s%s%s %s:%s:%d:CMP %s: Cannot parse int in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Missing ',' or end of -geninfo arg after int at %.40s%s%s %s:%s:%d:CMP %s: Missing 'int:' or 'str:' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unable to create 'OSSL_CMP_ITAV' structure%s%s%s %s:%s:%d:CMP %s: Failed to add ITAV for geninfo of the PKI message header%s%s%s %s:%s:%d:CMP %s: out of memory%s%s%s error setting verification parameters for %s %s:%s:%d:CMP %s: -tls_used given without -tls_trusted; will not authenticate the TLS server%s%s%s TLS client certificate (optionally with chain)%s:%s:%d:CMP %s: unable to use client TLS certificate file '%s'%s%s %s:%s:%d:CMP %s: could not add untrusted cert to TLS client cert chain%s%s%s %s:%s:%d:CMP %s: trying to build cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: success building cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: could not build cert chain for own TLS cert%s%s%s error: unable to add TLS extra certs %s:%s:%d:CMP %s: TLS private key '%s' does not match the TLS certificate '%s' %s %s:%s:%d:CMP %s: unable to use TLS client private key '%s'%s%s %s:%s:%d:CMP %s: -tls_used given without -tls_key; cannot authenticate to the TLS server%s%s%s , and -key option superseded by -csrfallback public key for cert to be enrolledpublic key for checking cert resulting from p10crreference certificate (oldcert) only if -rspin argument gives too few filenames%s:%s:%d:CMP %s: missing -server or -use_mock_srv or -rspin option%s%s%s %s:%s:%d:CMP %s: ignoring -proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: ignoring -no_proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: cannot parse -server URL: %s%s%s %s:%s:%d:CMP %s: assuming -tls_used since -server URL indicates HTTPS%s%s%s %s:%s:%d:CMP %s: no -infotype option given for genm%s%s%s %s:%s:%d:CMP %s: -infotype option is ignored for commands other than 'genm'%s%s%s %s:%s:%d:CMP %s: unknown OID name in -infotype option%s%s%s %s:%s:%d:CMP %s: -oldwithold %s%s%s option is ignored unless -cmd 'genm' and -infotype rootCaCert is given%s:%s:%d:CMP %s: -newwithnew %s%s%s %s:%s:%d:CMP %s: -newwithold %s%s%s %s:%s:%d:CMP %s: -oldwithnew %s%s%s %s:%s:%d:CMP %s: -template %s%s%s option is ignored unless -cmd 'genm' and -infotype 'certReqTemplate' is given%s:%s:%d:CMP %s: -keyspec %s%s%s %s:%s:%d:CMP %s: missing -template option for genm with infotype certReqTemplate%s%s%s %s:%s:%d:CMP %s: -trusted option is ignored since -srvcert option is present%s%s%s %s:%s:%d:CMP %s: -recipient option is ignored since -srvcert option is present%s%s%s directly trusted CMP server certificatetrusted certs for verifying newly enrolled cert%s:%s:%d:CMP %s: -total_timeout argument = %d must not be < %d (-msg_timeout)%s %s:%s:%d:CMP %s: -reqin is ignored since -rspin is present%s%s%s %s:%s:%d:CMP %s: -reqin_new_tid is ignored since -reqin is not present%s%s%s %s:%s:%d:CMP %s: missing -tls_key option%s%s%s %s:%s:%d:CMP %s: missing -tls_cert option%s%s%s %s:%s:%d:CMP %s: must give -key or -secret unless -unprotected_requests is used%s%s%s %s:%s:%d:CMP %s: must give -ref if no -cert and no -subject given%s%s%s %s:%s:%d:CMP %s: must give both -cert and -key options or neither%s%s%s %s:%s:%d:CMP %s: -cert and -key not used for protection since -secret is given%s%s%s private key for CMP client certificate%s:%s:%d:CMP %s: will not authenticate server due to missing -secret, -trusted, or -srvcert%s%s%s CMP client certificate (optionally with chain)trusted certs for verifying own CMP signer cert%s:%s:%d:CMP %s: -own_trusted option is ignored without -cert%s%s%s %s:%s:%d:CMP %s: digest algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: digest algorithm name not supported: '%s'%s%s %s:%s:%d:CMP %s: MAC algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: no -subject given; no -csr or -oldcert or -cert available for fallback%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) to be certified and no -csr, -oldcert, -cert, or -reqin option given, which could provide fallback public key. Neither central key generation is requested.%s%s%s %s:%s:%d:CMP %s: POPO is disabled, which implies -centralkeygen%s%s%s %s:%s:%d:CMP %s: -popo value %d is inconsistent with -centralkeygen%s%s %s:%s:%d:CMP %s: -newkeyout not given, nowhere to save centrally generated key%s%s%s %s:%s:%d:CMP %s: no -newkey option given with private key for POPO, -csr option provides just public key%s%s%s %s:%s:%d:CMP %s: since -reqin is used, may use -popo -1 or -popo 0 to disable the needless generation of a POPO%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) option for key to be certified and for POPO%s%s%s %s:%s:%d:CMP %s: -certout not given, nowhere to save newly enrolled certificate%s%s%s %s:%s:%d:CMP %s: -subject %s since sender is taken from -ref or -cert%s%s option is ignored for commands other than 'ir', 'cr', and 'kur'%s:%s:%d:CMP %s: -issuer %s and 'rr'%s%s %s:%s:%d:CMP %s: -reqexts %s%s%s %s:%s:%d:CMP %s: -san_nodefault %s%s%s %s:%s:%d:CMP %s: -sans %s%s%s %s:%s:%d:CMP %s: -policies %s%s%s %s:%s:%d:CMP %s: -policy_oids %s%s%s %s:%s:%d:CMP %s: -popo %s%s%s %s:%s:%d:CMP %s: -popo -1 or -centralkeygen %s%s%s %s:%s:%d:CMP %s: -newkeyout %s%s%s %s:%s:%d:CMP %s: -implicit_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -disable_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -certout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -chainout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: missing -oldcert for certificate to be updated and no -csr given%s%s%s %s:%s:%d:CMP %s: given -subject '%s' overrides the subject of '%s' for KUR%s %s:%s:%d:CMP %s: missing -oldcert or -issuer and -serial for certificate to be revoked and no -csr given%s%s%s %s:%s:%d:CMP %s: ignoring -csr since certificate to be revoked is given%s%s%s %s:%s:%d:CMP %s: Must give both -issuer and -serial options or neither%s%s%s %s:%s:%d:CMP %s: Ignoring -oldcert since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: Ignoring -csr since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: cannot read serial number: '%s'%s%s %s:%s:%d:CMP %s: Ignoring -serial for command other than 'rr'%s%s%s %s:%s:%d:CMP %s: missing PKCS#10 CSR for p10cr%s%s%s %s:%s:%d:CMP %s: missing -recipient, -srvcert, -issuer, -oldcert or -cert; recipient for any requests not covered by -reqin will be set to "NULL-DN"%s%s%s %s:%s:%d:CMP %s: -newkeypass %s%s%s option is ignored for 'p10cr', 'rr', and 'genm' commands%s:%s:%d:CMP %s: -newkey %s%s%s %s:%s:%d:CMP %s: -days %s%s%s %s:%s:%d:CMP %s: -out_trusted %s%s%s new private key for cert to be enrolled%s:%s:%d:CMP %s: could not set requested cert validity period%s%s%s %s:%s:%d:CMP %s: cannot have policies both via -policies and via -policy_oids%s%s%s %s:%s:%d:CMP %s: -csr option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: cannot load certificate request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot load policy cert request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot have Subject Alternative Names both via -reqexts and via -sans%s%s%s %s:%s:%d:CMP %s: bad syntax of %s '%s'%s %s:%s:%d:CMP %s: -opt_san_nodefault has no effect when -sans is used%s%s%s %s:%s:%d:CMP %s: -opt_policy_oids_critical has no effect unless -policy_oids is given%s%s%s %s:%s:%d:CMP %s: Invalid -policy_oids arg '%s'%s%s %s:%s:%d:CMP %s: Unknown -policy_oids arg: %.40s%s%s %s:%s:%d:CMP %s: cannot add policy with OID '%s'%s%s %s:%s:%d:CMP %s: -oldcert option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: will contact %s%s%s %s:%s:%d:CMP %s: received %d %s certificate(s), saving to file '%s' %s:%s:%d:CMP %s: saving more than one certificate in non-PEM format%s%s%s %s:%s:%d:CMP %s: could not open file '%s' for %s %s certificate(s) error: unsupported type '%s' for writing certificates %s:%s:%d:CMP %s: cannot write %s certificate to file '%s'%s %s:%s:%d:CMP %s: Failed to delete %s, which should be done to indicate there is no %s%s %s:%s:%d:CMP %s: genp does not contain any ITAV%s%s%s %s:%s:%d:CMP %s: could not get ITAV #%d from genp%s%s %s:%s:%d:CMP %s: error parsing type of ITAV #%d from genp%s%s %s:%s:%d:CMP %s: ITAV #%d from genp infoType=%s%s assertion failed: OSSL_NELEM(cmp_vars) == n_options + OPT_PROV__FIRST + 1 - OPT_PROV__LAST + OPT_R__FIRST + 1 - OPT_R__LAST + OPT_V__FIRST + 1 - OPT_V__LASTNon-positive number "%ld" for config option -%s Negative number "%ld" for config option -%s %s:%s:%d:CMP %s: internal: unsupported type '%c' for option '%s'%s %s:%s:%d:CMP %s: for option '%s' in config file section '%s'%s integer value out of range for option '%s' %s:%s:%d:CMP %s: Logging verbosity level %d out of range (0 .. 8)%s%s %s:%s:%d:CMP %s: -keep_alive argument must be 0, 1, or 2%s%s%s %s:%s:%d:CMP %s: invalid popo spec. Valid values are -1 .. 2%s%s%s %s:%s:%d:CMP %s: invalid revreason. Valid values are -1 .. 6, 8 .. 10%s%s%s Configuration file to use. "" = none. Default from env variable OPENSSL_CONFSection(s) in config file to get options from. "" = 'default'. Default 'cmp'Log level; 3=ERR, 4=WARN, 6=INFO, 7=DEBUG, 8=TRACE. Default 6 = INFOCMP request to send: ir/cr/kur/p10cr/rr/genmInfoType name for requesting specific info in genm, with specific supportfor 'caCerts' and 'rootCaCert'Certificate profile name to place in generalInfo field of request PKIHeaderComma-separated list of OID and value to place in generalInfo PKIHeaderof form :int: or :str:, e.g. '1.2.3.4:int:56789, id-kp:str:name'File to save certTemplate received in genp of type certReqTemplateOptional file to save Key specification received in genp of type certReqTemplateCertificate enrollment options: Private or public key for the requested cert. Default: CSR key or client keyNew private key pass phrase sourceRequest central (server-side) key generation. Default is local generationFile to save centrally generated key, in PEM formatDistinguished Name (DN) of subject to use in the requested cert templateFor kur, default is subject of -csr arg or reference cert (see -oldcert)this default is used for ir and cr only if no Subject Alt Names are setRequested validity time of the new certificate in number of daysName of config file section defining certificate request extensions.Augments or replaces any extensions contained CSR given with -csrSubject Alt Names (IPADDR/DNS/URI) to add as (critical) cert req extensionDo not take default SANs from reference certificate (see -oldcert)Name of config file section defining policies certificate request extensionPolicy OID(s) to add as policies certificate request extensionFlag the policy OID(s) given with -policy_oids as criticalProof-of-Possession (POPO) method to use for ir/cr/kur where-1 = NONE, 0 = RAVERIFIED, 1 = SIGNATURE (default), 2 = KEYENCPKCS#10 CSR file in PEM or DER format to convert or to use in p10crCertificates to trust when verifying newly enrolled certificatesRequest implicit confirmation of newly enrolled certificatesDo not confirm newly enrolled certificate w/o requesting implicitconfirmation. WARNING: This leads to behavior violating RFC 4210File to save newly enrolled certificateFile to save the chain of newly enrolled certificateCertificate enrollment and revocation options: Certificate to be updated (defaulting to -cert) or to be revoked in rr;also used as reference (defaulting to -cert) for subject DN and SANs.Issuer is used as recipient unless -recipient, -srvcert, or -issuer givenDN of the issuer to place in the certificate template of ir/cr/kur/rr;also used as recipient if neither -recipient nor -srvcert are givenSerial number of certificate to be revoked in revocation request (rr)Reason code to include in revocation request (rr); possible values:0..6, 8..10 (see RFC5280, 5.3.1) or -1. Default -1 = none included[http[s]://]address[:port][/path] of CMP server. Default port 80 or 443.address may be a DNS name or an IP address; path can be overridden by -path[http[s]://]address[:port][/path] of HTTP(S) proxy to use; path is ignoredList of addresses of servers not to use HTTP(S) proxy forDefault from environment variable 'no_proxy', else 'NO_PROXY', else noneDN of CA. Default: subject of -srvcert, -issuer, issuer of -oldcert or -certHTTP path (aka CMP alias) at the CMP server. Default from -server, else "/"Persistent HTTP connections. 0: no, 1 (the default): request, 2: requireNumber of seconds allowed per CMP message round trip, or 0 for infiniteOverall time an enrollment incl. polling may take. Default 0 = infiniteServer authentication options: Certificates to use as trust anchors when verifying signed CMP responsesIntermediate CA certs for chain construction for CMP/TLS/enrolled certsServer cert to pin and trust directly when verifying signed CMP responsesDN of expected sender of responses. Defaults to subject of -srvcert, if anyIgnore CMP signer cert key usage, else 'digitalSignature' must be allowedAccept missing or invalid protection of regular error messages and negativecertificate responses (ip/cp/kup), revocation responses (rp), and PKIConfWARNING: This setting leads to behavior allowing violation of RFC 4210Do not keep certificates received in the extraCerts CMP message fieldFile to save the server cert used and validated for CMP response protectionFile to save extra certificates received in the extraCerts fieldFile to save CA certs received in caPubs field or genp with id-it-caCertsRoot CA certificate to request update for in genm of type rootCaCertFile to save NewWithNew cert received in genp of type rootCaKeyUpdateFile to save NewWithOld cert received in genp of type rootCaKeyUpdateFile to save OldWithNew cert received in genp of type rootCaKeyUpdatecertificate to request a CRL for in genm of type crlStatusListCRL to request update for in genm of type crlStatusListFile to save new CRL received in genp of type 'crls'Client authentication options: Reference value to use as senderKID in case no -cert is givenPrefer PBM (over signatures) for protecting msgs with given password sourceClient's CMP signer certificate; its public key must match the -key argumentThis also used as default reference for subject DN and SANs.Any further certs included are appended to the untrusted certsOptional certs to verify chain building for own CMP signer certCMP signer private key, not used when -secret givenClient private key (and cert and old cert) pass phrase sourceDigest to use in message protection and POPO signatures. Default "sha256"MAC algorithm to use in PBM-based message protection. Default "hmac-sha1"Certificates to append in extraCerts field of outgoing messages.This can be used as the default CMP signer cert chain to includeSend request messages without CMP-level protectionFormat (PEM or DER) to use when saving a certificate to a file. Default PEMFormat (PEM or DER) to use when saving a CRL to a file. Default DERFormat of the key input (ENGINE, other values ignored)Pass phrase source potentially needed for loading certificates of othersUse crypto engine with given identifier, possibly a hardware device.Engines may also be defined in OpenSSL config file engine section.Provider load path (must be before 'provider' argument if required)Provider to load (can be specified multiple times)Set a provider key-value parameterProperty query used when fetching algorithmsLoad the given file(s) into the random number generatorWrite random data to the specified fileEnable using TLS (also when other TLS options are not set)Client's TLS certificate. May include chain to be provided to TLS serverPrivate key for the client's TLS certificatePass phrase source for the client's private TLS key (and TLS cert)Extra certificates to provide to TLS server during TLS handshakeTrusted certificates to use for verifying the TLS server certificate;this implies hostname validationAddress to be checked (rather than -server) during TLS hostname validationClient-side debugging options: Do not interactively prompt for input when a password is required etc.Invoke the transaction the given positive number of times. Default 1Take sequence of CMP requests to send to server from file(s)Use fresh transactionID for CMP requests read from -reqinSave sequence of CMP requests created by the client to file(s)Save first CMP request created by the client to file and exitProcess sequence of CMP responses provided in file(s), skipping serverSave sequence of actually used CMP responses to file(s)Use internal mock server at API level, bypassing socket-based HTTPAct as HTTP-based mock server listening on given portmax number of messages handled by HTTP mock server. Default: 0 = unlimitedReference value to use as senderKID of server in case no -srv_cert is givenPassword source for server authentication with a pre-shared key (secret)Private key used by the server for signing messagesServer private key (and cert) pass phrase sourceTrusted certificates for client authenticationIntermediate certs that may be useful for verifying CMP protectionCertificate to be expected for rr and any oldCertID in kur messagesCertificate to be returned as mock enrollment resultPrivate key for the certificate to be returned as mock enrollment resultKey to be returned for central key pair generationResponse private key (and cert) pass phrase sourceCRL to be returned in genp of type crlsExtra certificates to be included in mock certification responsesCA certificates to be included in mock ip responseNew root CA certificate to include in genp of type rootCaKeyUpdateNewWithOld transition cert to include in genp of type rootCaKeyUpdateOldWithNew transition cert to include in genp of type rootCaKeyUpdateNumber of times the client must poll before receiving a certificateThe check_after value (time to wait) to include in poll responseGrant implicit confirmation of newly enrolled certificatePKIStatus to be included in server response. Possible values: 0..6A single failure info bit number to include in server response, 0..26Number representing failure bits to include in server response, 0..2^27 - 1Status string to be included in server responseForce server to reply with error messageSend response messages without CMP-level protectionIn case of negative responses, server shall send unprotected error messages,certificate responses (ip/cp/kup), and revocation responses (rp).WARNING: This setting leads to behavior violating RFC 4210Accept missing or invalid protection of requestsAccept unprotected error messages from clientAccept RAVERIFIED as proof-of-possession (POPO)adds policy to the acceptable policy setchain authentication security levelpermit unhandled critical extensionscheck leaf certificate revocationset policy variable require-explicit-policyset policy variable inhibit-any-policyset policy variable inhibit-policy-mappingdisable certificate compatibility work-aroundsprint policy processing diagnosticssearch trust store first (default)Suite B 128-bit mode allowing 192-bit algorithmsaccept chains anchored by intermediate trust-store CAsignore certificate validity timeallow the use of proxy certificatesVerbose listing of the SSL/TLS ciphersConvert standard name into OpenSSL nameCipher specification options: Ciphers compatible with TLS1.1Ciphers compatible with TLS1.2Ciphers compatible with TLS1.3Include ciphersuites requiring PSK(deprecated) Include ciphersuites requiring SRPConfigure the TLSv1.3 ciphersuites to useCipher string to decode (optional)Usage: %s [options] [certreq...] Verbose output during processingTerse output during processingCSR input format to use (PEM or DER; by default try PEM first)The last argument, requests to processWhere to put the output file(s)Datetime format used for printing. (rfc_822/iso_8601). Default is rfc_822.Do not print the generated certificatemsie modifications to handle all Universal StringsFile contains a self signed cert to signFile contains DN and signed public key and challengeUse engine, possibly a hardware deviceThe particular CA definition to useUse arg instead of request's subjectInput characters are UTF8; default ASCIIIf reading serial fails, create a new random serialAlways create a random serial; do not store itDeprecated; multi-valued RDNs support is always on.[CC]YYMMDDHHMMSSZ value for notBefore certificate field[CC]YYMMDDHHMMSSZ value for notAfter certificate field, overrides -daysNumber of days from today to certify the cert forExtension section (override value in config file)Configuration file with X509v3 extensions to addDon't add the EMAIL field to the DNDigest to use, such as sha256; see openssl help for listPrivate key file format (ENGINE, other values ignored)Key and cert input file pass phrase sourceKey to decrypt the private key or cert files if encrypted. Better use -passinCertificate input format (DER/PEM/P12); has no effectSign a cert with the key associated with itSignature parameter in n:v formVerification parameter in n:v formAdd a Valid(not-revoked) DB entry about a cert (given in file)Shows cert status given the serial numberCRL extension section (override value in config file)the hold instruction, an OID. Sets revocation reason to certificateHoldsets compromise time to val and the revocation reason to keyCompromisesets compromise time to val and the revocation reason to CACompromiseSets the CRL lastUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Sets the CRL nextUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Days until the next CRL is dueHours until the next CRL is dueSeconds until the next CRL is dueCertificate requests to be signed (optional)input format - one of DER PEM B64output file (output format is always DER)offset; a series of these can be used to 'dig'string to generate ASN1 structure frominto multiple ASN1 blob wrappingsfile to generate ASN1 structure fromequivalent to '-inform pem' (obsolete)dump the first arg bytes of unknown data in hex formporoqqqpqq`sPs0ssrrrPrxhX@(pX0pXX8hЏH8(ЍxXpX08؋x ,|l<41('(''(<)$) )(***l*\*D*,**t,\,L,4,, ,++l+\+D+,++***//t/\/D/,/....l.T.<.,.. .-----|-d-L-4---,,,,,))))))l)T)(`'`'&//a/P/?/./11111111o1`1O1?1.11 100000000s0b0Q0@0/000/////////r/..&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&H'H'H'H'-P-Hset_verbosityget_optsopt_strread_config-M-Sprint_itavsdelete_filesave_free_certssetup_verification_ctxsetup_protection_ctxset_gennamessetup_request_ctxsetup_client_ctxhandle_opt_geninfoset_fallback_pubkeysetup_ssl_ctxtransform_optsread_write_req_respread_PKIMESSAGEwrite_PKIMESSAGE0123456789ABCDEFprocess_pollReqprocess_certConfprocess_errorcheck_client_crlprocess_genmprocess_rrprocess_cert_requestclean_transactiondelayed_deliveryossl_cmp_mock_srv_set1_newWithNewossl_cmp_mock_srv_set1_caPubsOutossl_cmp_mock_srv_set1_chainOutossl_cmp_mock_srv_set1_certOutossl_cmp_mock_srv_set1_refCertmock serverpkix/Not FoundInternal Server Errorapplication/pkixcmp%s:%s:%d:CMP %s: No %s%s%s Key %s: Key algorithm: Key algorithm: RSA %d Invalid key spec: %s End of key %s%s:%s:%d:CMP %s: %.*s%s Bad input format for %s rbCAdESCMSInvalid key %s Invalid id %s Invalid OID %s recipient certificate fileNo key specified key param bufferapps/cms.cNo secret key id originator certificate fileSMIMECan't read content file %s Error writing certs to %s Can't open receipt file %s signer certificateError creating CMS structure %s Verification successful %s Verification failure Error writing signers to %s Signer %d: No Receipt Request Signed Content ID: Receipts From List: : First Tier : All Unknown (%d) Receipts To: To: %s%sFrom: %s%sSubject: %s%sMissing CRL signing key other CRLCRL signing keyError creating delta CRL issuer=crlNumber=0xissuer name hash=%08lx issuer name old hash=lastUpdate=nextUpdate=NONE%s Fingerprint=%02X%cunable to write CRL unable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object RSA-%-25s\ *%s apps/dgst.c%s(%s)= Read error in %s Verified OK Error verifying data Signature bufferError signing data Digest bufferError Digesting Data etaonrishdlcupfmSHA256I/O bufferSupported digests: MAC parameter error "%s" Error getting context Error setting context Error setting digest signature bufferDHXsafe type-specificSubjectPublicKeyInfoMSBLOBError getting passwords unable to load Key Not a DSA key Public Key=writing DSA key %s format not supported encrypt-levelinvalid PVK encryption level unable to write key apps/dsa.cread DSA key This could take some time DSA parameters from PBMAC secret of mock servercerts trusted by mock servercaPubs for mock serverNewWithNew cert from genpNewWithOld cert from genpOldWithNew cert from genpCRL from genp of type 'crls'certTemplate from genpkeySpec from genpwbPKIStatusInfo bufvalidated servernewly enrolled cert and chainnewly enrolledAES-256-CBCInput options: Input fileInput format - DER or PEMOutput fileoutformOutput format - DER or PEMPrint as textNo outputVerbose outputTerse outputgenkeyGenerate a DSA keynumbitsnumqbitsAny supported cipherpvk-strongpvk-weakpvk-noneDon't enforce PVK encodingInput keypubinInput file pass phrase sourceOutput format, DER PEM PVKDon't print key outPrint the key in textPrint the DSA public valuepuboutpassoutCheck the DH parametersdsaparamInput format, DER or PEMOutput format, DER or PEMList digestsengine_implPrint as hex dumpbinaryPrint in binary formxoflenPrint debug infoSign digest using private keyprverifyFile with signature to verifyhmacCreate hashed MAC with keymacoptAny supported digestfips-fingerprintnocrlcertfileVerify CRL signatureInput file - default stdinoutput file - default stdoutOutput format - default PEMPrint hash valuenameoptCRL options: Print issuer DNSet lastUpdate fieldSet nextUpdate fieldNo CRL outputPrint the crl fingerprintPrint CRL numberbadsiggendeltano-CAfileno-CApathno-CAstoreOperation options: Encrypt messageDecrypt encrypted messageSign messageVerify signed messageresignResign a signed messagesign_receiptverify_receiptdigest_createdigest_verifyuncompressEncryptedData_encryptEncryptedData_decryptdata_createCreate a CMS "Data" objectdata_outcmsoutOutput CMS structureFile format options: rctformReceipt file formatEnable CMS streamingSame as -streamnoindefDisable CMS streamingcrlfeolasciicrlfKeys and passwords options: pwri_passwordsecretkeysecretkeyidinkeyoriginatorOriginator certificate filerecipRecipient cert filecert...aes128-wrapUse AES128 to wrap keyaes192-wrapUse AES192 to wrap keyaes256-wrapUse AES256 to wrap keydes3-wrapUse 3DES-EDE to wrap keydebug_decryptDigest algorithm to useSigner certificate input filecadesnodetachUse opaque signingnocertsnoattrnosmimecapno_signing_timereceipt_request_allreceipt_request_firstreceipt_request_fromreceipt_request_toVerification options: no_content_verifyno_attr_verifynosigsnoverifynointernverify_retcodeTrusted certificates fileUse subject key identifierecontent_typeOID for external contentCertificate output fileTo addressFrom addressSubjectPrinting options: receipt_request_printPrint CMS Receipt Request%s:%s:%d:CMP %s: expecting empty path or 'pkix/' but got '%s'%s%s specifications contained in keySpec from genp%s:%s:%d:CMP %s: Out of memory - cannot dump key %s%s%s %s:%s:%d:CMP %s: Info too large - cannot dump key %s%s%s Error allocating CMS_contentinfo Error reading %s Content Info Invalid key (supplied twice) %s Invalid id (supplied twice) %s Invalid OID (supplied twice) %s Illegal -inkey without -signer %s: Unknown option or message digest: %s %s: Unknown option or cipher: %s No Signed Receipts Recipients Signed receipts only allowed with -sign Multiple signers or keys not allowed Incompatible options: CAdES requires signed attributes Incompatible options: CAdES validation requires certs and signed attributes validations No signer certificate specified No recipient certificate or key specified No recipient(s) certificate(s) specified No operation option (-encrypt|-decrypt|-sign|-verify|...) specified. Warning: -nodetach option is ignored for non-signing operation Warning: -contfile option is ignored for the given operation Warning: recipient certificate file parameters ignored for operation other than -encrypt receipt signer certificate fileCannot use -digest for non-signing operation Cannot use -digest when -in, -nodetach or streaming is used Invalid hex value after -digest Cannot use originator for encryption Signed Receipt Request Creation Error Error decrypting CMS using secret key Error decrypting CMS using private key Error decrypting CMS using password Error decrypting CMS structure Receipt Request Parse Error Bad output format for CMS file Error initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key Error getting maximum length of signed data key must be set for one-shot algorithms %s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and signing key cannot both be specified Signature parameter error "%s" Error opening signature file %s Error reading signature file %s Length can only be specified for XOF Signing key cannot be specified for XOF Error, failed to set DH parameters %s: Value "%s" outside integer range Error, generator may not be chosen for DSA parameters Warning, input file %s ignored Error, %s param generation context allocation failed Generating %s parameters, %d bit long %sprime Error, unable to initialise %s parameters Error, unable to set DSA prime length Error, unable to set DH prime length Error, unable to set generator Error, unable to load parameters Error, unable to load DSA parameters Error, unable to load DH parameters Error, failed to check DH parameters Error, invalid parameters generated DH parameters appear to be ok. Error, unable to write DH parameters PVK form impossible with public key input bad output format specified for outfile Error, DSA parameter generation context allocation failed Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Generating DSA parameters, %d bit long prime Error, DSA key generation paramgen init failed Error, DSA key generation setting bit length failed Error, DSA key generation setting subprime bit length failed Error, unable to write DSA parameters Error, DSA key generation context allocation failed Error, unable to initialise for key generation %s:%s:%d:CMP %s: using only first %d characters of section name starting with "%.*s" %s:%s:%d:CMP %s: using section(s) '%s' of OpenSSL configuration file '%s'%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'; will thus use just [default] and unnamed section if present%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'%s %s:%s:%d:CMP %s: cannot load engine %s%s%s %s:%s:%d:CMP %s: cannot set up error reporting and logging for %s%s%s %s:%s:%d:CMP %s: -tls_used given without any other TLS options%s%s%s %s:%s:%d:CMP %s: ignoring TLS options(s) since -tls_used is not given%s%s%s %s:%s:%d:CMP %s: -tls_used option not supported with -port option%s%s%s %s:%s:%d:CMP %s: The -port option excludes -server and -use_mock_srv%s%s%s %s:%s:%d:CMP %s: The -port option does not support -reqin and -reqout%s%s%s %s:%s:%d:CMP %s: The -port option does not support -rspin and -rspout%s%s%s %s:%s:%d:CMP %s: cannot use both -server and -use_mock_srv options%s%s%s %s:%s:%d:CMP %s: must give -srv_ref for mock server if no -srv_cert given%s%s%s %s:%s:%d:CMP %s: server credentials (-srv_secret or -srv_cert) must be given if -use_mock_srv or -port is used%s%s%s %s:%s:%d:CMP %s: server will not be able to handle PBM-protected requests since -srv_secret is not given%s%s%s %s:%s:%d:CMP %s: must give both -srv_cert and -srv_key options or neither%s%s%s signer certificate of the mock serverprivate key for mock server cert%s:%s:%d:CMP %s: mock server will not be able to handle signature-protected requests since -srv_trusted is not given%s%s%s untrusted certificates for mock serverreference cert to be expected by the mock server%s:%s:%d:CMP %s: no -rsp_cert given for mock server%s%s%s cert the mock server returns on certificate requestsprivate key for enrollment certCRL to be returned by the mock serverCMP extra certificates for mock serverNewWithNew cert the mock server returns in rootCaKeyUpdateNewWithOld cert the mock server returns in rootCaKeyUpdateOldWithNew cert the mock server returns in rootCaKeyUpdate%s:%s:%d:CMP %s: -failure out of range, should be >= 0 and <= %d%s%s %s:%s:%d:CMP %s: -failurebits overrides -failure%s%s%s %s:%s:%d:CMP %s: -failurebits out of range%s%s%s %s:%s:%d:CMP %s: ignoring -tls_used option since -use_mock_srv is given or -server is not given%s%s%s %s:%s:%d:CMP %s: -server %s%s%s option is ignored since -reqout_only option is given%s:%s:%d:CMP %s: -use_mock_srv %s%s%s %s:%s:%d:CMP %s: -reqout %s%s%s %s:%s:%d:CMP %s: -rspin %s%s%s %s:%s:%d:CMP %s: -rspout %s%s%s %s:%s:%d:CMP %s: -server option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: -use_mock_srv option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: cannot set up CMP context%s%s%s %s:%s:%d:CMP %s: Missing -cacertsout option for -infotype caCerts%s%s%s %s:%s:%d:CMP %s: no CA certificates provided by server%s%s%s %s:%s:%d:CMP %s: Failed to store CA certificates from genp in %s%s%s %s:%s:%d:CMP %s: Missing -newwithnew option for -infotype rootCaCert%s%s%s %s:%s:%d:CMP %s: No -oldwithold given, will use all certs given with -trusted as trust anchors for verifying the newWithNew cert%s%s%s OldWithOld cert for genm with -infotype rootCaCert%s:%s:%d:CMP %s: no root CA certificate update available%s%s%s %s:%s:%d:CMP %s: oldWithNew certificate received in genp for verifying oldWithOld, but oldWithOld was not provided%s%s%s %s:%s:%d:CMP %s: Missing -oldcrl and no -crlcert given for -infotype crlStatusList%s%s%s %s:%s:%d:CMP %s: Missing -crlout for -infotype crlStatusList%s%s%s Cert for genm with -infotype crlStatusListCRL for genm with -infotype crlStatusList%s:%s:%d:CMP %s: -oldcrl and -crlcert have different issuer%s%s%s %s:%s:%d:CMP %s: no CRL update available%s%s%s %s:%s:%d:CMP %s: received %s, saving to file '%s'%s %s:%s:%d:CMP %s: could not open file '%s' for writing %s%s error: unsupported type '%s' for writing CRLs %s:%s:%d:CMP %s: cannot write %s to file '%s'%s %s:%s:%d:CMP %s: no certificate request template available%s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored certTemplate from genp to file '%s'%s%s %s:%s:%d:CMP %s: no key specifications available%s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored keySpec from genp to file '%s'%s%s %s:%s:%d:CMP %s: No specific support for -infotype %s available%s%s %s:%s:%d:CMP %s: Failed to create genm for -infotype %s%s%s %s:%s:%d:CMP %s: Did not receive response on genm or genp is not valid%s%s%s %s:%s:%d:CMP %s: received%s%s %s Centrally generated private key password%s:%s:%d:CMP %s: saving centrally generated key to file '%s'%s%s Usage: %s [options] [numbits] [numqbits] Use engine e, possibly a hardware deviceNumber of bits if generating parameters or key (optional)Number of bits in the subprime parameter q if generating parameters or key (optional)Enable 'Strong' PVK encoding level (default)Enable 'Weak' PVK encoding levelInput format (DER/PEM/PVK); has no effectExpect a public key in input fileOutput public key, not privateOutput file pass phrase sourceUsage: %s [options] [numbits] Read or generate DSA parameters, convert to DHPrint a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 3 as the generator valueGenerate parameters using 5 as the generator valueNumber of bits if generating parameters (optional)Usage: %s [options] [file...] Also use engine given by -engine for digest operationsPrint the digest with separating colonsPrint the digest in coreutils formatOutput to filename rather than stdoutKey file format (ENGINE, other values ignored)Output length for XOF algorithms. To obtain the maximum security strength set this to 32 (or greater) for SHAKE128, and 64 (or greater) for SHAKE256Verify a signature using public keyVerify a signature using private keyCreate MAC (not necessarily HMAC)MAC algorithm parameters in n:v form or keyCompute HMAC with the key used in OpenSSL-FIPS fingerprintFiles to digest (optional; default is stdin)No crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedCRL input format (DER or PEM); has no effectCRL signing Private key to usePrivate key file format (DER/PEM/P12); has no effectPrint out a text format versionPrint old-style (MD5) hash valueCertificate subject/issuer name printing optionsCorrupt last byte of loaded CRL signature (for test)Other CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file nameVerify CRL using certificates in store URIDo not load the default certificates fileDo not load certificates from the default certificates directoryDo not load certificates from the default certificates storeUsage: %s [options] [cert...] Load a configuration file (this may load modules)Generate a signed receipt for a messageVerify receipts; exit if receipt signatures do not verifySign a pre-computed digest in hex notationCreate a CMS "DigestedData" objectVerify a CMS "DigestedData" object and output itCreate a CMS "CompressedData" objectUncompress a CMS "CompressedData" objectCreate CMS "EncryptedData" object using symmetric keyDecrypt CMS "EncryptedData" object using symmetric keyCopy CMS "Data" object to outputInput format SMIME (default), PEM or DEROutput format SMIME (default), PEM or DERTreat input as binary: do not translate to canonical formUse CRLF as EOL termination instead of LF onlyPerform CRLF canonicalisation when signingSpecific password for recipientUse specified hex-encoded key to decrypt/encrypt recipients or contentIdentity of the -secretkey for CMS "KEKRecipientInfo" objectInput private key (if not signer or recipient)Set public key parameters as n:v pairsInput private key format (ENGINE, other values ignored)Encryption and decryption options: Recipient certs (optional; used only when encrypting)The encryption algorithm to use (any supported cipher)Key wrap algorithm to use when encrypting with key agreementDisable MMA protection, return error if no recipient found (see doc)Extra signer and intermediate CA certificates to include when signingor to use as preferred signer certs and for chain building when verifyingInclude signingCertificate attribute (CAdES-BES)Don't include signer's certificate when signingDon't include any signed attributesOmit the SMIMECapabilities attributeOmit the signing time attributeWhen signing, create a receipt request for all recipientsWhen signing, create a receipt request for first recipientCreate signed receipt request with specified email addressCreate signed receipt targeted to specified addressSigner certificate(s) output fileSupply or override content for detached signatureDo not verify signed content signaturesDo not verify signed attribute signaturesDon't verify message signatureDon't verify signers certificateDon't search certificates in message for signerCheck signingCertificate (CAdES-BES)Exit non-zero on verification failureTrusted certificates directoryTrusted certificates store URIInclude or delete text MIME headersFor the -cmsout operation do not output the parsed CMS structureFor the -cmsout operation print out all fields of the CMS structureFor the -print option specifies various strings printing optionswgW;+ si_UH>1$ K;+|l[D0(f=$$X'H'0''&&&&&x&h&X&H&0&&%%%%p(`((''''''0/X1H1081001tBAE|DCC\ELE4EEFFEEEEEtElD\DDDDCCCU`TVVUVV`VPV@V@W0W WWWVV]],bb]baa^^^bbbbb|bdbLbHfPegggg0g g`ge@ggpgzzzzTxzset_nameprev_itemossl_cmp_mock_srv_set1_keyOutossl_cmp_mock_srv_set1_crlOutossl_cmp_mock_srv_set1_newWithOldossl_cmp_mock_srv_set1_oldWithNewossl_cmp_mock_srv_set_pollCountossl_cmp_mock_srv_set_checkAfterTimeossl_cmp_mock_srv_set_statusInfoossl_cmp_mock_srv_set_sendErrorsetup_srv_ctxsave_crlsave_templatesave_keyspecdo_genmprint_statuscmp_mainprint_keyspeccmp_serverThis command is not enabled in the Red Hat Enterprise Linux OpenSSL build, please consult Red Hat documentation to learn how to enable FIPS mode unable to set point conversion format unable to set asn1 encoding format unable to disable public key encoding unable to enable public key encoding CURVE DESCRIPTION NOT AVAILABLEusing curve name prime192v1 instead of secp192r1 using curve name prime256v1 instead of secp256r1 Unable to load parameters from %s checking elliptic curve parameters: unable to write elliptic curve parameters hex string is too long, ignoring excess hex string is too short, padding with zero bytes to length *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. warning: iv not used by this cipher Either a raw key or the 'skeyopt' args must be used. Error creating opaque key object for skeymgmt %s Error setting an opaque key for cipher %s %s: Cannot mix flags and engine names. unable to create PKEY context unable to set up for key generation unable to output generated key retrievable algorithm parametersretrievable operation parametersunknown type (%u) of %zu bytes settable key generation parameters Provided Asymmetric Encryption: Provided RNGs and seed sources: ERROR: could not list all provider signature algorithms No TLS sig algs registered by currently active providersERROR: setting TLS protocol version ERROR: getting implemented TLS group list WARNING: Unable to query provider parameters for %s Invalid command '%s'; type "help" for a list. Error initializing %s context The possible -pkeyopt arguments are: Error reading parameter file %s %s: Error setting %s parameter: Cannot use cipher with -genparam option Error writing to outpubkey: '%s'. Error: %s Error writing to outfile: '%s'. Error: %s Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Error allocating RSA public exponent Error setting RSA public exponent Error setting number of primes Certificate input, or CSR input file with -req (default stdin)Private key and cert file pass-phrase sourceGenerate a certificate from scratchOutput a certification request (rather than a certificate)Input is a CSR file (rather than a certificate)copy extensions when converting from CSR to x509 or vice versaCSR verification parameter in n:v formKey for signing, and to include unless using -force_pubkeyKey input format (ENGINE, other values ignored)Output format (DER or PEM) - default PEMNo cert output (except for requested printing)No output (except for requested printing)Certificate printing options: Print the certificate in text formVarious certificate text printing optionsPrint the certificate fingerprintPrint both notBefore and notAfter fieldsSynonym for -subject_hash (for backward compat)Print old-style (MD5) subject hash valuePrint old-style (MD5) issuer hash valueRestrict which X.509 extensions to print and/or copyPrint OCSP hash values for the subject name and public keyPrint out certificate purposesPrint the public key in PEM formatCertificate checking options: Check whether cert expires in the next arg secondsExit 1 (failure) if so, 0 if notCheck certificate matches hostCheck certificate matches emailCheck certificate matches ipaddrSerial number to use, overrides -CAserialIncrement current certificate serial numberNumber of days until newly generated certificate expires - default 30Preserve existing validity datesSet or override certificate issuerSet or override certificate subject (and issuer)Key to be placed in new certificate or certificate requestDo not take over any extensions from the source certificate or requestConfig file with X509V3 extensions to addSection of extfile to use - default: unnamed sectionSignature parameter, in n:v formCorrupt last byte of certificate signature (for test)Any supported digest, used for signing and printingUse the given CA certificate, conflicts with -keyCA cert format (PEM/DER/P12); has no effectThe corresponding CA key; default is -CA argCA key format (ENGINE, other values ignored)File that keeps track of CA-generated serial numberCreate CA serial number file if it does not existCertificate trust output options: Mark certificate PEM output as trustedSet certificate alias (nickname)Trust certificate for a given purposeClears all the prohibited or rejected uses of the certificateReject certificate for a given purposeShow some internal datatype optionsPrint extra information about the operations being performed.A file of trusted certificatesA directory of files with trusted certificatesURI to a store of trusted certificatesDo not load the default trusted certificates fileDo not load trusted certificates from the default directoryDo not load trusted certificates from the default certificates storeA file of untrusted certificatesFile containing one or more CRL's (in PEM format) to loadTry downloading CRL information for certificates via their CDP entriesDisplay information about the certificate chainCertificate(s) to verify (optional; stdin used otherwise)Section to use within config fileFile with private key for replySearch by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hexPrint a text form of the objectsUsage: %s [options] [user...] The particular srp definition to useModify the SRP verifier of an existing userDelete user from verifier fileSet g and N values to be used for new verifierAdditional info to be set for userUsername(s) to process (optional)Specify the name of an SPKAC-dedicated section of configurationCreate SPKAC using private keySign new SPKAC with the specified digest (default: MD5)Usage: %s [options] [algorithm...] All +int options consider prefix '0' as base-8 input, prefix '0x'/'0X' as base-16 input. Enable (tls1>=1) multi-block mode on EVP-named cipherProduce machine readable outputEnable async mode and start specified number of jobsSpecify number of primes (for RSA only)Lock memory for better result determinismRun the speed command in test modeUse EVP-named cipher or digestTime decryption instead of encryption (only EVP)Benchmark EVP-named AEAD cipher in TLS-like sequenceBenchmark signature algorithmsUse wall-clock time instead of CPU user time as divisorRun benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized bufferUse specified offset to mis-align buffersAlgorithm(s) to test (optional; otherwise tests all)Digest algorithm to use when signing or resigningDon't translate message to textDon't include signers certificate when signingVerification/Decryption options: Recipient certificate file for decryptionset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAsRecipient certs, used when encryptingKey options as opt:value for opaque keys handlingSymmetric key management name for opaque keys handlingGenerate an opaque symmetric keyThe cipher to generate key forInput format - default PEM (DER or PEM)Output format - default PEM (PEM, DER or NSS)Don't output the encoded session infoWhere to connect as post:port (default is localhost:4433)Specify TLSv1.3 ciphersuites to be usedTurn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the siteCert file to use, PEM format assumedFile with key, PEM; default is -cert fileDo not load certificates from the default certificates store URIConfigure SSL_CTX using the given configuration valueTCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onFor -unix, unlink existing socket firstDon't use any certificates (Anon-DH)Turn on peer certificate verificationTurn on peer certificate verification, must have a certServer certificate file to use; default server.pemCertificate file to use for servername; default server2.pemServer certificate file format (PEM/DER/P12); has no effectServer certificate chain file in PEM formatBuild server certificate chainPEM serverinfo file for certificatePrivate key file to use; default is -cert file or elseserver.pem-Private Key file to use for servername if not in -cert2Key format (ENGINE, other values ignored)Private key and cert file pass phrase sourceSecond server certificate file to use (usually for DSA)Second server certificate file format (PEM/DER/P12); has no effectsecond server certificate chain file in PEM formatSecond private key file to use (usually for DSA)Second key file format (ENGINE, other values ignored)Second private key and cert file pass phrase sourceServername for HostName TLS extensionOn servername mismatch send fatal alert (default warning alert)Test with the non-blocking test bioConvert LF from terminal into CRLFDisable caching and tickets if ephemeral (EC)DH is usedRespond to a 'GET /' with a status pageRespond to a 'GET with the file ./pathDo not treat lack of close_notify from a peer as an errorHex dump of all TLS extensions receivedLike -WWW but ./path includes HTTP headersGenerate SSL/TLS session IDs prefixed by argExport keying material using labelExport len bytes of keying material; default 20CRL file format (PEM or DER); default PEMDownload CRLs from distribution points in certificate CDP entriesCA file for certificate chain (PEM format)use dir as certificate store path to build CA certificate chainuse URI as certificate store to build CA certificate chainCA file for certificate verification (PEM format)use dir as certificate store path to verify CA certificateuse URI as certificate store to verify CA certificateDisable internal cache, set up and use external cacheClose connection on verification errorNo verify output except verify errorsIgnore input EOF (default when -quiet)Pre-compress server certificatesRequest certificate status from serverPrint more output in certificate status callbackStatus request responder timeout[http[s]://]host[:port][/path] of HTTP(S) proxy to use; path is ignoredFile containing DER encoded OCSP ResponsePrint output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkRestrict output to brief summary of connection parametersact as an echo server that sends back received text reversedFile to send output of -msg or -trace, instead of stdoutMaximum number of encrypt/decrypt pipelines to be usedTerminate after #num connectionsDefault read buffer size to be used for connectionsSize used to split data for encrypt pipelinesFile to read PSK SSL session from(deprecated) The verifier file for SRP(deprecated) A seed string for a default user saltProtocol and version options: The maximum number of bytes of early data as advertised in ticketsThe maximum number of bytes of early data (hard limit)The number of TLSv1.3 session tickets that a server will automatically issueSwitch on anti-replay protection (default)Switch off anti-replay protectionopening files in binary mode when acting as http server (-WWW and -HTTP)Disable TLS Extension CA NamesListen for a DTLS ClientHello with a cookie and then connectOffer SRTP key management with a colon-separated profile listSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)Enable Kernel TLS for sending and receivingUse sendfile to response file with -WWWUse zerocopy mode of KTLS sendfileEnable raw public keys (RFC7250) from the serverEnable raw public keys (RFC7250) from the clientDisable SSL/TLS compression (default)Disable sending TLSv1.3 compressed certificatesDisable receiving TLSv1.3 compressed certificatesDisable use of TLS session ticketsUse server's cipher preferencesEnable use of legacy renegotiation (dangerous)Allow client-initiated renegotiationAllow initial connection to servers that don't support RIDisallow session resumption on renegotiationDisallow initial connection to servers that don't support RIIn TLSv1.3 allow non-(ec)dhe based key exchange on resumptionIn TLSv1.3 prefer non-(ec)dhe over (ec)dhe-based key exchange on resumptionPrioritize ChaCha ciphers when preferred by clientsEnforce strict certificate checks as per TLS standardSignature algorithms to support (colon-separated list)Signature algorithms to support for client certificate authentication (colon-separated list)Groups to advertise (colon-separated list)Elliptic curve used for ECDHE (server-side only)Specify TLSv1.2 and below cipher list to be usedSpecify the minimum protocol version to be usedSpecify the maximum protocol version to be usedBlock size to pad TLS 1.3 records to.Perform all sorts of protocol violations for testing purposesDisable TLSv1.3 middlebox compat modeDisable Encrypt-then-Mac extensionDisable Extended master secret extensionExtended certificate options: cert for Extended certificateschain for Extended certificatesbuild certificate chain for the extended certificatesformat of Extended certificate (PEM/DER/P12); has no effectformat of Extended certificate's key (DER/PEM/P12); has no effectUsage: %s [options] [host:port] Specify engine to be used for client certificate operationsUse specified section for SSL_CTX configurationRequest and parse SCTs (also enables OCSP stapling)Do not request or parse SCTs (default)TCP/IP where to connect; default: 4433)bind local address for connectionConnect to via specified proxy to the real serverUserID for proxy authenticationProxy authentication password sourceConnect over the specified Unix-domain socketEnable Maximum Fragment Length Negotiation (len values: 512, 1024, 2048 and 4096)Client certificate file to useClient certificate file format (PEM/DER/P12); has no effectClient certificate chain file (in PEM format)Build client certificate chainPrivate key file to use; default: -cert filePEM format file of CA names to send to the serverDANE TLSA rrdata presentation formDisable name checks when matching DANE-EE(3) TLSA recordsHostname to use for "-starttls lmtp", "-starttls smtp" or "-starttls xmpp[-server]"Drop and re-make the connection with the same Session-IDIgnore input eof (default when -quiet)Use the appropriate STARTTLS command before starting TLSAlias of -name option for "-starttls xmpp[-server]"Print session information when the program exitsDon't run the client in the interactive modeShow all certificates sent by the serverEnable security debug messagesOutput more security debug outputShow trace output of protocol messagesDo not use interactive command lettersSet TLS extension servername (SNI) in ClientHello (default)Do not send the server name (SNI) extension in the ClientHellotypes Send empty ClientHello extensions (comma-separated numbers)Enable ALPN extension, considering named protocols supported (comma-separated list)Support asynchronous operationEnable send/receive timeout on DTLS connectionsEnable NPN extension, considering named protocols supported (comma-separated list)Enable post-handshake-authentication(deprecated) SRP authentication for 'user'(deprecated) Password for 'user'(deprecated) SRP username into second ClientHello message(deprecated) Tolerate other than the known g N values.(deprecated) Minimal length in bits for NDownload CRL from distribution pointsCRL format (PEM or DER); default PEMRestrict verify output to errorsUse dir as certificate store path to build CA certificate chainCA store URI for certificate chainUse dir as certificate store path to verify CA certificateCA store URI for certificate verificationWhere to connect; same as -connect optionInput key, by default an RSA private keyPrivate key format (ENGINE, other values ignored)Input key is an RSA public pkeyInput is a cert carrying an RSA public keyReverse the order of the input bufferUse PKCS#1 v1.5 padding (default)Run output through asn1parse; useful with -verifyInput format (DER/PEM/P12/ENGINE)Output format, one of DER PEM PVKUse traditional format for private keysSpecify the cipher for private key encryptionSpecify engine to be used for key generation operationsX.509 request input file (default stdin)Verify self-signature on the requestConfig section to use (default "req")Input characters are UTF8 (default ASCII)Output an X.509 certificate structure instead of a cert requestRequest cert generation with X.509 version 1Issuer cert to use for signing a cert, implies -x509Issuer private key to use with -CA; default is -CA argSet or modify subject of request or certPrint the subject of the output request or certNumber of days certificate is valid forcopy extensions from request when using -x509Cert or request extension section (override value in config file)Additional cert extension key=value pair (may be given more than once)Add a poison extension to generated cert (implies -new)Key for signing, and to include unless -in givenPrivate key and certificate password sourceGenerate new key with [:] or [:] or param:Public key options as opt:valueDo not ask anything during request generationDon't encrypt private keys; deprecatedOutput "NEW" in the header linesUsage: %s [options] [directory...] Create both new- and old-style hash linksUse old-style hash to generate linksOne or more directories to process (optional)Usage: %s [options] num[K|M|G|T] Usage: %s [options] [number...] When used with -generate, generate a safe primeNumber(s) to check for primality if not generatingAlso use engine given by -engine for crypto operationsSign input data with private keyEncrypt input data with public keyDecrypt input data with private keyDerive shared secret from own and peer (EC)DH keysInput key, by default private keyPeer key file used in key derivationPeer key format (DER/PEM/P12/ENGINE)Input is a cert with a public keySignature file (verify operation only)File to store secret on encapsulationparse the output as ASN.1 data to check its DER encoding and print errorsVerify RSA signature, recovering original signature input dataSigning/Derivation/Encapsulation options: Indicate that the signature/verification input data is not yet hashedThe digest algorithm to use for signing/verifying raw input data. Implies -rawinPublic key option that is read as a passphrase argument opt:passphraseKEM operation specific to the key algorithmDon't output encoded parametersRead only public components from key inputOutput file for encoded and/or text outputOutput encoding format (DER or PEM)Any supported cipher to be used for encryptionOutput PEM file pass phrase sourceUse traditional format for private key PEM outputRestrict encoded output to public componentsDo not output the key in encoded formOutput key components in plaintextOutput only public key components in text formSpecifies the EC point conversion form in the encodingSpecifies the way the EC parameters are encodedSet the PRF algorithm to use with PKCS#5 v2.0Use or expect unencrypted private keyuse traditional format private keySpecify the salt length (in bytes)Default: 8 (For PBE1) or 16 (for PBE2)Print full details of certificatesPrint out all fields of the PKCS7 structurePrint_certs print any certs or crl in the inputWhen used with -print_certs, it produces a cleaner outputSet PKCS#12 import/export password sourceSeparate MAC, encryption passwordsDon't output anything, just verify PKCS#12 inputUse legacy encryption: 3DES_CBC for keys, RC2_CBC for certsPKCS#12 import (parsing PKCS#12) options: Print info about PKCS#12 structureOnly output client certificatesAny supported cipher for output encryptionPKCS#12 output (export) options: Private key, else read from -in input fileExtra certificates for PKCS12 outputCertificate file pass phrase sourceBuild and add certificate chain for EE cert,which is the 1st cert from -in matching the private key (if given)Untrusted certificates for chain buildingUse name as CA friendly name (can be repeated)Add local machine keyset attribute to private keySet key type to MS key exchangeSet key type to MS key signaturePrivate key PBE algorithm (default AES-256 CBC)Certificate PBE algorithm (default PBES2 with PBKDF2 and AES-256 CBC)Encrypt output with 3DES (default PBES2 with PBKDF2 and AES-256 CBC)Digest algorithm to use in MAC (default SHA256)Use PBMAC1 with PBKDF2 instead of MACDigest to use for PBMAC1 KDF (default SHA256)Specify the iteration count for encryption and MACDon't use encryption iterationUnused, kept for backwards compatibilityMark certificate in PKCS#12 store as trusted for JDK compatibilityUsage: %s [options] [password] Never verify when reading password from terminalSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantAIX MD5-based password algorithmPassword text to digest (optional)Ignore error on OCSP request or response and continue runningConnection timeout (in seconds) to the OCSP responderDon't include any certificates in responserun multiple responder processesDon't include any certificates in signed requestCorrupt last byte of loaded OCSP response signature (for test)Number of minutes before next updateNumber of requests to accept (default unlimited)File with the DER-encoded requestCertificate to sign OCSP request withAdditional certificates to include in signed requestNumber of days before next updateResponder certificate to sign responses withResponder key to sign responses withResponder key pass phrase sourceOther certificates to include in responseDigest Algorithm to use in signature of OCSP responseOCSP response signature parameter in n:v formUse specified algorithm for cert id in responseAny supported digest algorithm (sha1,sha256, ... )TCP/IP hostname:port to connect toDon't add OCSP nonce to requestDon't check signature on responseIdentify response by signing certificate key IDDon't check signing certificatePrint text form of request and responseDon't do additional checks on signing certificateDo not explicitly check the chain, just verify the rootDon't verify additional certificatesDon't search certificates contained in response for signerFile with the DER-encoded responseAdditional certificates to search for signerCertificate to check; may be given multiple timesSerial number to check; may be given multiple timesMaximum validity discrepancy in secondsPrivate key to sign OCSP request withOutput file for the DER-encoded requestOutput file for the DER-encoded responseMAC algorithm parameters in n:v formSee 'PARAMETER NAMES' in the EVP_MAC_ docsInput file to MAC (default is stdin)Output in binary format (default is hexadecimal)Usage: help [options] [command] Name of command to display help (optional)Set options for strict FIPS complianceVerify a config file instead of generating oneFile name of the provider moduleFIPS Provider config section name (optional)Disable the ability of the fips module to enter an error state if any conditional self tests failDisable the run-time FIPS security checks in the moduleForces self tests to always run on module loadForces self tests to run once on module installationEnable the run-time FIPS check for EMS during TLS1_PRFDisallow truncated digests with Hash and HMAC DRBGsEnable checking for approved digests for signaturesEnable digest check for TLS13-KDFEnable digest check for TLS1-PRFEnable digest check for SSHKDFEnable digest check for X963KDFDisallow Triple-DES encryptionDisallow PKCS#1 version 1.5 padding for RSA encryptionEnable salt length check for RSA-PSS signature operationsDisallow X931 Padding for RSA signingEnable key check for TLS13-KDFDisable lower bound check for PBKDF2Enable Cofactor check for ECDHInput config file, used when verifyingOutput config file, used when generatingMAC algorithm parameters in n:v form.Disable logging of self test eventsCorrupt a self test by descriptionList of message digest commands (deprecated)List of message digest algorithmsList of key derivation and pseudo random function algorithmsList the primary, public and private random number generator detailsList of random number generatorsList of message authentication code algorithmsList of cipher commands (deprecated)List of symmetric cipher algorithmsList of symmetric key managersList of key exchange algorithmsList of key encapsulation mechanism algorithmsList of TLS signature algorithmsList of asymmetric cipher algorithmsList implemented TLS key exchange 'groups'List implemented TLS key exchange 'groups' and all aliasesWhen listing 'groups', list those compatible with TLS1.2When listing 'groups', list those compatible with TLS1.3List options for specified commandList built in objects (OID<->name mappings)KDF algorithm control parameters in n:v formSee 'Supported Controls' in the EVP_KDF_ docs The size of the output derived keyDefault configuration file directoryDefault engine module directoryDefault module directory (other than engine modules)Configured extension for modules(deprecated) Use 3 for the E valueUse the Fermat number F4 (0x10001) for the E valueOutput the key to specified fileEncrypt the output with any supported cipherOutput status while generating keysDo not output status while generating keysSet the public key algorithm option as opt:valueCipher to use to encrypt the keyOrder of options may be important! See the documentation. Usage: %s [options] dsaparam-file Output the key to the specified fileFile containing DSA parametersUsage: %s [options] errnum... Usage: %s [options] engine... Check that specified engine is availableRun command against the ENGINE before loading itRun command against the ENGINE after loading itList 'control commands' For each specified engineAlso display each command's descriptionAlso add the input flags for each commandAlso show internal input flagsList the capabilities of specified engineDisplay error trace for unavailable enginesCommands are like "SO_PATH:/lib/libdriver.so"Base64 encode/decode, depending on encryption flagUsed with -[base64|a] to specify base64 buffer as a single lineDisable standard block paddingUse specified digest to create a key from the passphraseSpecify the iteration count and force the use of PBKDF2Use password-based key derivation function 2 (PBKDF2)Use -iter to change the iteration count from 10000Specify the PBKDF2 salt length (in bytes)Compress or decompress encrypted data using zlibKey options as opt:value for opaque symmetric key handlingSymmetric key management name for opaque symmetric key handlingPrints a list of all curve 'short names'Print the ec parameters in text formSpecifies the way the ec parameters are encodedCheck that named EC curve parameters have not been modifiedIf 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'Specifies the point conversion form Print the elliptic curve parametersexclude public key from private keypoint-formatinclude-publicunable to print EC key unable to check EC key EC Key Invalid! EC Key valid. writing EC key unable to write EC key apps/ec.cread EC key %s => %s prime192v1prime256v1list curvesapps/ecparam.c %-10s: secp192r1secp256r1groupSM2sm2unable to generate key EC parametersECSM2 parametersunable to clear seed unable to print params group-checkunable to set check_type algorithm nameapps/kdf.cnon-hex digit base64zlibSupported ciphers: %s Can't read key from %s %s: out of memory bufsize=%d strbufevp bufferUnstreamable cipher mode encryptiondecryptionenter %s %s password:bad password read invalid hex salt value RAND_bytes failed error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed EVP_BytesToKey failed invalid hex iv value iv undefined invalid hex key value Error setting cipher %s salt=key=iv =bad encrypt bad decrypt bytes read : %8ju bytes written: %8ju apps/enc.c%s: zero length password engine bufferapps/engine.cSTORE(%s)Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] description buffer%s%s(input flags): [Internal] STRINGNUMERIC|NO_INPUT<0x%04X> %lxparams fileapps/gendsa.cUndefined%s: Only one item allowed %s: No items chosen Invalid KDF name %s KDF parameter error Invalid derived key length. out bufferEVP_KDF_derive failed %s ERROR: Memory allocation %sLegacy: %sProvided: @ %s description: %s %*sEmpty list of %s (!!!) settable operation parametersProvided MACs: Provided KDFs and PDFs: uninitialisedready %s state = %s state%*s%s: %llu error getting value %lld <%zu bytes> Provided ENCODERs: @ %s (%s) Provided DECODERs: Name: Type: Provider Algorithm IDs: tls-sigalg-iana-nameTLS-SIGALG%-*sProvided STORE LOADERs: ExternalBuiltin(none)- - %s %c Digests: Symmetric Ciphers: Provided Key Exchange: Provided Signatures: Provided Key encapsulation: Provided Key managers: primaryprivateapps/list.c%s%c Key Managers: Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Encryption: Providers: buildinfo name: %s version: %s status: %sactive build info: %s gettable provider parametersEngines: Disabled algorithms: EC2M MDC2 SM2 SM4 SSL3 BROTLI ZSTD # None-OID object: %s, %s %s = %s %s = %s, %s uintfloat %s%s:%s Can't open parameter file %s Error initializing context Bad format specified for key Error writing key(s) Error printing key apps/genpkey.cAlgorithm already set! Error setting RSA length Error cannot access RSA e e is %s (0x%s) apps/genrsa.capps/mac.cx509toreqsignkeySame as -keyOutput file - default stdoutnocertcertoptPrint certificate aliasPrint serial number valuePrint the notBefore fieldPrint the notAfter fieldPrint subject DNPrint email address(es)subject_hashPrint subject hash valuesubject_hash_oldissuer_hashPrint issuer hash valueissuer_hash_oldocspidocsp_uriPrint OCSP Responder URL(s)Print the RSA key moduluscheckendcheckhostcheckemailcheckipCertificate output options: set_serialnext_serialpreserve_datesset_issuerAlias for -set_subjectforce_pubkeyclrextMicro-CA options: CAformCAkeyCAkeyformCAserialCAcreateserialtrustoutsetaliasclrtrustClear all trusted purposesaddtrustclrrejectaddrejectShow all dataShow build dateShow configuration directoryShow engines directoryShow modules directoryShow compiler flags usedShow target build platformShow random seeding optionsShow library versionShow CPU settings infoCertificate chain options: CRLfilecrl_downloadshow_chainConfiguration fileSigner certificate fileFile with signer CA chainFile with trusted CA certsPath to trusted CA filesURI to trusted CA storeExtra untrusted certstoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileQuery options: Generate a TS queryFile to hashDigest (as a hex string)queryfileFile containing a TS queryPut cert request into queryVerify options: Verify a TS responseGenerate a TS replytspolicyPolicy OID to useno_nonceDo not include a nonceOutput text (not DER)Usage: %s [options] uri Search options: Search for certificates onlySearch for keys onlycrlsSearch for CRLs onlySearch by subjectSearch by aliasRecurse through namesNo PEM output, just statusURI of the store objectTalk a lot while doing thingsAction options: Add a user and SRP verifiermodifydeleteList userssrpvfileThe srp verifier file nameuserinfospksectchallengeChallenge stringAlternative SPKAC nameDon't print SPKACOutput public keyVerify SPKAC signaturembmrRun benchmarks in parallelasync_jobsmlocktestmodeSelection options: evpHMAC using EVP-named digestcmacCMAC using EVP-named cipheraeadkem-algorithmsBenchmark KEM algorithmsTiming options: elapsedmisalignpk7outOutput PKCS#7 structureSigning/Encryption options: Email options: nochainskeyoptskeymgmtSet the session ID contextPrint ssl session id detailsOutput certificate Connection options: Just time new connectionsJust time connection reusebugsTurn on SSL bug compatibilityJust use TLSv1.0Just use TLSv1.1Just use TLSv1.2Just use TLSv1.3wwwcafilePEM format file of CA'sPEM format directory of CA'sURI to store of CA'sssl_configtracetrace protocol messagesNetwork options: unixunlinkUse IPv4 onlyUse IPv6 onlyIdentity options: Set session ID contextcert2build_chainserverinfokey2dcertformdcert_chaindkeydkeyformdpassdhparamDH parameters file to useservername_fatalnbio_testNo server outputno_resume_ephemeralWWWignore_unexpected_eoftlsextdebugHTTPid_prefixkeymatexportkeymatexportlenCRL file to useCRLformchainCAfilechainCApathchainCAstoreverifyCAfileverifyCApathverifyCAstoreno_cacheDisable session cacheext_cacheverify_return_errorverify_quietno_ign_eofDo not ignore input EOFOCSP options: status_verbosestatus_timeoutstatus_urlStatus request fallback URLstatus_fileDebug options: security_debugsecurity_debug_verbosebriefPrint more outputmsgShow protocol messagesmsgfilePrint the SSL statesasyncOperate in asynchronous modemax_pipelinesnacceptkeylogfileWrite TLS secrets to filenbioUse non-blocking IOEnable timeoutsmtuSet link-layer MTUread_bufsplit_send_fragmax_send_fragMaximum Size of send frames Server identity options: PSK identity to expectpsk_hintPSK identity hint to usePSK in hex (without 0x)psk_sessionsrpuserseedrecv_max_early_dataAttempt to read early datanum_ticketsno_anti_replayhttp_server_binmodeno_ca_namesstatelessRequire TLSv1.3 cookiesJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3dtlsUse any DTLS versionlistendtls1Just talk DTLSv1dtls1_2Just talk DTLSv1.2sctpUse SCTPsctp_label_bugEnable SCTP label length buguse_srtpno_dheDisable ephemeral DHnextprotonegalpnktlszerocopy_sendfileenable_server_rpkenable_client_rpkTLS/SSL options: no_ssl3Just disable SSLv3no_tls1Just disable TLSv1no_tls1_1Just disable TLSv1.1no_tls1_2Just disable TLSv1.2no_tls1_3Just disable TLSv1.3no_compUse SSL/TLS-level compressionno_tx_cert_compno_rx_cert_compno_ticketserverpreflegacy_renegotiationclient_renegotiationDisable all renegotiation.no_resumption_on_renegno_legacy_server_connectallow_no_dhe_kexprefer_no_dhe_kexprioritize_chachaclient_sigalgsnamed_curvemin_protocolmax_protocolrecord_paddingdebug_broken_protocolno_middleboxno_etmno_emsxkeykey for Extended certificatesxcertxchainxchain_buildxcertformxkeyformssl_client_enginenoctctlogfileCT log list CONF fileUse -connect insteadbindproxy_userproxy_passmaxfraglenfallback_scsvSend the fallback SCSVrequestCAfiledane_tlsa_domainDANE TLSA base domaindane_tlsa_rrdatadane_ee_no_namechecksPSK identitySession options: reconnectsess_outFile to write SSL session tosess_inFile to read SSL session fromInput/Output options: No s_client outputDon't ignore input eofstarttlsxmpphostprexitno-interactiveshowcertsExtra outputMore ssl protocol testingPrint the ssl statesnocommandsadvAdvanced command modenoservernameJust use TLSv1Use any version of DTLSquicUse QUICSet the link layer MTUJust use DTLSv1Just use DTLSv1.2File to send as early dataenable_phasrpusersrppasssrp_lateusersrp_moregroupssrp_strengthhost:portSign with private keyVerify with public keyEncrypt with public keyDecrypt with private keycertinrawUse no paddingpkcsx931Use ANSI X9.31 paddingoaepUse PKCS#1 OAEPasn1parsehexdumpHex dump outputVerify key consistencyRSAPublicKey_inInput is an RSAPublicKeyOutput a public keyRSAPublicKey_outOutput is an RSAPublicKeytraditionalPVK options: keygen_engineNew requestRequest template filereqoptVarious request text optionsText form of requestx509x509v1(Required by some CA's)Serial number to useAn alias for -extensionsaddextprecertKeys and Signing options: File to write private key topkeyoptnoencDon't encrypt private keysnodesDo not output REQnewhdrRSA moduluscompatDo not remove existing linksBase64 encode outputHex encode outputNumber of bytes to generateSize of number in bitsNumber of checksHex outputGenerate a primesafederivedecapDecapsulate shared secretencapEncapsulate shared secretInput key is a public keypeerkeypeerformsigfileverifyrecoverrawinpkeyopt_passinkdfUse KDF algorithmkdflenKDF algorithm output lengthkemopCheck key param consistencyPrint parameters as textCheck key consistencypubcheckCheck public key consistencyKey input pass phrase sourcetext_pubec_conv_formec_param_encUse PKCS#5 v1.5 and cipherv2Use PKCS#5 v2.0 and cipherv2prfInput format (DER or PEM)nocryptOutput format (DER or PEM)topk8Output PKCS8 fileSpecify the iteration countUse 1 as iteration countScrypt options: scryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterDon't output encoded dataprint_certstwopassnokeysDon't output private keysDon't output certificateslegacynomacverDon't verify integrity MACclcertscacertsOnly output CA certificatesCreate PKCS12 filepasscertsPEM-format file of CA'sPEM-format directory of CA'sUse name as friendly namecanameCSPMicrosoft CSP nameLMKkeyexkeysigkeypbecertpbemacalgpbmac1_pbkdf2pbmac1_pbkdf2_mdnomaciterDon't use MAC iteration)macsaltlenSpecify the salt len for MACnomacDon't generate MACjdktrustRead passwords from fileRead passwords from stdinNo warningsFormat output as tablereverseSwitch table columnsCryptographic options: Use provided saltapr1MD5-based password algorithmaixmd5ignore_errResponder options: resp_no_certsnminnrequestsign_otherindexCertificate status index filendaysrsignerrotherrmdrsigoptkey=value header to addrcidClient options: Responder URLPort to run responder onPath to use in OCSP requestOutput filenameDon't verify response at allAdd OCSP nonce to requestno_signature_verifyresp_key_idno_cert_verifyreq_textPrint text form of requestresp_textPrint text form of responseno_chainDon't chain verify responseno_cert_checksno_explicittrust_otherno_internrespinVAfileValidator certificates fileverify_othervalidity_periodrespoutIssuer certificatestatus_ageMaximum status age in secondstoseqOutput NS Sequence fileUsage: %s [options] mac_name CipherDigestmac_nameMAC algorithmcommandpedanticmoduleprovider_nameFIPS provider namesection_nameno_conditional_errorsno_security_checksself_test_onloadself_test_oninstallems_checkno_short_macDisallow short MAC outputno_drbg_truncated_digestssignature_digest_checkhmac_key_checkEnable key check for HMACkmac_key_checkEnable key check for KMACEnable digest check for HKDFtls13_kdf_digest_checktls1_prf_digest_checksshkdf_digest_checksskdf_digest_checkEnable digest check for SSKDFx963kdf_digest_checkdsa_sign_disabledDisallow DSA signingtdes_encrypt_disabledrsa_pkcs15_padding_disabledrsa_pss_saltlen_checkrsa_sign_x931_disabledEnable key check for HKDFkbkdf_key_checkEnable key check for KBKDFtls13_kdf_key_checktls1_prf_key_checkEnable key check for TLS1-PRFsshkdf_key_checkEnable key check for SSHKDFsskdf_key_checkEnable key check for SSKDFx963kdf_key_checkEnable key check for X963KDFx942kdf_key_checkEnable key check for X942KDFno_pbkdf2_lower_bound_checkecdh_cofactor_checkcorrupt_desccorrupt_typeCorrupt a self test by typeThe parent config to verifyNo messages, just exit statusList in one columnVerbose listingselectSelect a single algorithmList of standard commandsstandard-commandsall-algorithmsList of all algorithmsdigest-commandsdigest-algorithmskdf-algorithmsrandom-instancesrandom-generatorsmac-algorithmscipher-commandsencodersList of encoding methodsdecodersList of decoding methodsList of key managersskey-managerskey-exchange-algorithmsList of signature algorithmstls-signature-algorithmsasymcipher-algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsstore-loadersList of store loadersall-tls-groupsprovidersList of provider informationList of loaded enginesList of disabled featuresobjectscmscrl2pkcs7dgstecparamerrstrfipsinstallgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs8pkeyparampkeyutlrehashrsautls_clients_servers_timesess_idskeyutlsmimespeedstoreutlmd2md4sha224sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdes3desxidearc4rc4-40rc2bfcastrc5des-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbidea-cbcidea-ecbidea-cfbidea-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcrc5-cbcrc5-ecbrc5-cfbrc5-ofbUsage: %s [options] kdf_name kdfoptkeylenkdf_nameName of the KDF algorithmconfigdirenginesdirmodulesdirdsoextdirnamesepDirectory-filename separatorlistsepList separator characterseedsSeed sourcescpusettingswindowscontextWindows install contextUsage: %s [options] numbits F4f4Specify number of primesSize of key in bitsparamfileParameters fileThe public key algorithmOutput (private key) fileoutpubkeyOutput public key fileoutput format (DER or PEM)genparamGenerate parameters, not keyPrint the private key in textdsaparam-fileerrnumError number(s) to decodeprepostvvvvttID of engine(s) to loadList ciphersAlias for -listEncryptDecryptPrint the iv/keyPrint the iv/key and exitPassphrasekfileRead passphrase from filePassphrase sourceSame as option -anopadUse salt in the KDF (default)nosaltDo not use salt in the KDFbufsizeBuffer sizeRaw key, in hexSalt, in hexIV in hexDefault: 10000Don't encryptDefault: 16uncompressedhybridlist_curvesGenerate ec keyInput file - default stdinDo not print the ec parameterParameter options: Validate the ec parameterscheck_namedno_seedcheck key consistencyPrint the keyparam_outno_public`@X8 p`P8 HP@((0 p  x h xh0P8$#$$$$%$3243333282)666d67666666h:h:9899x989(:P$POPOOTPO|ppsds|spvvvuutuduTuDu4u$uuttttttttttdtTtDt4ttsssss0Ж pP8ԗ|ԞܝĞ̟Salted__apps/rehash.cInvalid MAC name %s MAC parameter error EVP_MAC_Init failed Read Error in '%s' EVP_MAC_update failed EVP_MAC_final failed output len is too large subject=The command %s is deprecated. Use '%s' instead.--helpUsage: %s %s: Standard commandsPassword: apps/passwd.cprivate key from -in fileprivate key from -inkey filecertpbe and -descertiter and -noiterEnter MAC Password:Can't read Password certificates from -in fileError getting chain: %s Enter Export Password:Error creating PBMAC1 Enter Import Password:MAC: using PBKDF2, Iteration %ld PBKDF2 PRF: %s Warning: MAC is absent! apps/pkcs12.cPKCS12KDFPKCS7 Data PKCS7 Encrypted data: unable to load PKCS7 object %s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key apps/pkcs8.cPublic KeyKey is valid Key is invalid apps/pkey.cError reading parameters Parameters are valid Parameters are invalid oneshot sign/verify bufferError reading raw input data buffer outputError signing raw input data apps/pkeyutl.c(unknown key type)%s: Error loading key Error: out of memory peer keyError reading peer key %s Enter %s: user abort entry failed failed to get '%s' Can't open signature file %s Error reading signature data Error reading input Data secret outputPublic Key operation error Key derivation failed isis notSpecify the number of bits. Out of memory. Failed to generate prime. apps/prime.cFailed to process value (%s) Error checking prime (%s) %s prime Missing number (s) to check Invalid size suffix %s buffer for output fileapps/rand.chash bucketcollision bucketError creating SSL context. application/ocsp-responseapplication/ocsp-request (core dumped)apps/ocsp.cissuer certificateError Creating OCSP request Error reading OCSP request responder certificateresponder other certificatesresponder private keychild PID arraywaitpid() failed: %sapps/lib/http_server.cRAND_poll() failedterminating on signal: %dindex file changed, reloadingsigner private keysigner certificatesError signing OCSP request assertion failed: bnassertion failed: itmpError reading OCSP response Responder Error: %s (%d) validator certificatesError parsing response Nonce Verify error Response Verify Failure Response verify OK ERROR: No Status found. This Update: Next Update: Reason: %s Revocation Time: apps_startupprog_initorg.openssl.engineOPENSSL_TEST_LIBCTXnull--h--version--vapps/openssl.cCannot write random bytes: apps/lib/app_rand.c%.*s %02X %s (%s) Skipping %s, can't write Doing %s Skipping %s, out of memory filename buffer%s%s%slink %s -> %s %s%s%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s crtcer%s: Error reading certs file %s %s: Error reading sequence file %s The command %s was deprecated in version %s. Message Digest commands (see the `dgst' command for more details) Cipher commands (see the `enc' command for more details) %s: Can't combine -in and -stdin Warning: -%s option ignored with -export Warning: output encryption option -%s ignored with -export Warning: -%s option ignored without -export Error getting certificate file password Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password Nothing to export due to -noout or -nocerts and -nokeys Warning: -chain option ignored with -nocerts No certificate in -in file %s No cert in -in file '%s' matches private key No end entity certificate to check with -chain extra certificates from -certfileError creating PKCS12 structure for %s Error creating PKCS12 MAC; no PKCS12KDF support? Use -nomac or -pbmac1_pbkdf2 if PKCS12KDF support not available , Unsupported KDF or params for PBMAC1 Key length: %ld, Salt length: %d MAC length: %ld, salt length: %ld Error verifying PKCS12 MAC; no PKCS12KDF support. Use -nomacver if MAC verification is not required. Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates unable to allocate PKCS7 object Warning: The -text option is ignored with -text_pub Warning: The -traditional is ignored since there is no PEM output Warning: The -passout option is ignored without a cipher option Error: Cipher options are supported only for PEM output Error: Text output cannot be combined with DER output Error: unable to determine file size for oneshot operation Error verifying raw input data %s: no KDF length given (-kdflen parameter). %s: no private key given (-inkey parameter). %s: -peerkey option not allowed without -derive. %s: missing -peerkey option for -derive operation. A private key is needed for this operation %s: -verifyrecover can be used only with RSA %s: -rev cannot be used with raw input %s: -digest (prehash) is not supported with %s %s: -digest and -rawin can only be used with -sign or -verify The given KDF "%s" is unknown. %s: Error initializing context Type of peer public key: %s does not match type of private key: %s %s: Error setting up peer key %s: Can't set parameter "%s": %s: Signature file specified for non verify %s: No signature file specified for verify %s: Decapsulation produces only a shared secret and no output. The '-out' option is not applicable. KEM-based shared-secret derivation requires the '-secret ' option Error: The non-raw input data length %zd is too long - max supported hashed size is %d Signature Verified Successfully Signature Verification Failure %lu bytes with suffix overflows Request exceeds max allowed output %s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s Error querying OCSP responder %s Error parsing -url argument No issuer certificate specified Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error loading responder certificate Responder mode requires certificate, key, and CA. error detaching from parent process group: %sinternal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%swaiting for OCSP client connections...error reloading updated index: %sNeed an OCSP request for this operation! Error loading signer certificate WARNING: no nonce in response WARNING: Status times invalid. internal error: no free child slotsOpenSSL application user interfaceFailed to create null provider Failed to create library context FATAL: Startup failure (dev note: %s()) for %s %s: could not get default config file %s: error: skipping %s, cannot open file %s: warning: skipping %s, it does not contain exactly one certificate or CRL %s: error calculating SHA1 hash value 00PP(PНH8P@(xX ܥ̥|l\L<, ԧħtĦ\D,t\,̨l\L<\L p`@t\D4$\,t$LhX(0 xTtP`P@ p`H0P0@@@@pX0T&((xhP8(ohX@0`x`0HXxx`H XC= -1 Parse error on -addext: missing '=' Parse error on -addext: missing key Internal error handling -addext %s Warning: Ignoring -days without -x509; not generating a certificate Warning: Ignoring -not_before without -x509; not generating a certificate Warning: Ignoring -not_after without -x509; not generating a certificate Warning: Ignoring -copy_extensions 'none' when -x509 is not given Warning: Will read cert request from stdin since no -in option is given Using additional configuration from -addext options Problems opening '%s' for extra OIDs Error checking %s extension section %s Error checking extensions defined using -addext Warning: Not generating key via given -newkey option since -key is given Parameter file requested but no path given: %s Cannot open parameter file %s Key type does not match parameters Error allocating keygen context Error initializing keygen context Private key length too short, needs to be at least %d bits, not %ld. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: Not placing -key in cert or request since request is used Warning: Ignoring -in option since -new or -newkey or -precert is given Warning: Ignoring -CAkey option since no -CA option is given Issuer CA certificate and key do not match Must provide a signature key using -key or provide -CA / -CAkey Error: No objects specified in config file You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. Please enter the following 'extra' attributes to be sent with your certificate request No template, please set one up. Error making certificate request Warning: Not using -key or -newkey for signing since -CA option is given Warning: -not_after option overriding -days option Warning: No -copy_extensions given; ignoring any extensions in the request Error copying extensions from request Warning: Signature key and public key of cert do not match Error adding x509 extensions from section %s Error adding x509 extensions defined via -addext Error adding poison extension Warning: Ignoring -precert flag since no cert is produced Error adding request extensions from section %s Error adding request extensions defined via -addext Modifying subject of certificate request Error modifying subject of certificate request Certificate request self-signature verify failure Certificate request self-signature verify OK Error printing certificate request Unable to write certificate request Unable to write X509 certificate OCSP response: no response sent response parse error {help}: Get this help text DONE RECONNECTING RENEGOTIATING noreqKEYUPDATE ERROR --- Reused, --- New, --- Certificate chain %2d s: i: v:NotBefore: ; NotAfter: Server certificate Server raw public key no peer rpk available --- SCTs present (%i) SCT validation status: %s --- %s, Cipher is %s Protocol: %s Server public key is %d bit Compression: %s Expansion: %s Using Kernel TLS for sending Next protocol: (%d) ALPN protocol: No ALPN negotiated Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: smtpIPv6 IPv4 unix mail.example.comlocalhostcbufsbufmbufError writing file %s Not a hex number '%s' %s: Value must be one of: %s: Can't use both -4 and -6 Can't use -sctp without DTLS Error getting proxy password client certificateclient certificate chainError adding CRL Unable to create BIO Error setting verify params Error loading CA names Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Unable to set SRP username Can't open session file %s Can't set session Connecting via TFO apps/lib/s_socket.cConnecting to %s connect:errno=%d CONNECTED(%08X) memory allocation failure getsockname:errno=%d Failed to set MTU LHLO %s EHLO %s STARTTLSSTLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS To issue a command insert {cmd} or {cmd:arg} anywhere in the text Entering {{ will send { to the peer The following commands are available {quit}: Close the connection to the peer {reconnect}: Reconnect to the peer {fin}: Send FIN on the stream. No further writing is possible {keyup:req|noreq}: Send a Key Update message Arguments: req = peer update requested (default) noreq = peer update not requested {reneg}: Attempt to renegotiate a:PKEY: %s, (%s); sigalg: %s a:PKEY: %s, %d (bit); sigalg: %s no peer certificate available Client-to-server raw public key negotiated Server-to-client raw public key negotiated --- SSL handshake has read %ju bytes and written %ju bytes Using Kernel TLS for receiving SRTP Extension negotiated, profile=%s %s: Intermixed protocol flags (unix and internet domains) %s: Intermixed protocol flags (internet and unix domains) Cannot supply multiple protocol flags Cannot supply both a protocol flag and '-no_' Error getting client auth engine SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: cannot provide both -connect option and target parameter %s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together Cannot supply -nextprotoneg with TLSv1.3 %s: -connect argument or target parameter malformed or ambiguous %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument Error getting private key password Error: Must specify proxy_user with proxy_pass client certificate private keyError using configuration "%s" %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Error setting client certificate types Error setting server certificate types Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. %s: DTLS does not support the -tfo option %s: QUIC does not support the -tfo option %s: QUIC requires ALPN to be specified (e.g. "h3" for HTTP/3) via the -alpn option assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Can't bind %saddress for %s%s%s MTU too small. Must be at least %ld Failed to set the initial peer address Didn't find STARTTLS in server response, trying anyway... Timeout waiting for response (%d seconds). Server does not support STARTTLS. MySQL packet length does not match. Only MySQL protocol version 10 is supported. Cannot confirm server version. MySQL server handshake packet is broken. MySQL server does not support SSL. ldap_ExtendedResponse_parse failed STARTTLS failed, LDAP Result Code: %i drop connection and then reconnect ERROR PROCESSING COMMAND. REST OF LINE IGNORED: %s UNRECOGNISED COMMAND (IGNORED): %s BAD ARGUMENT (COMMAND IGNORED): %s Error: client did not send PSK identity PSK warning: client identity not what we expected (got '%s' expected '%s') cert_status: Cannot open OCSP response file cert_status: Error reading OCSP response cert_status: can't parse AIA URL cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: ALPN protocols advertised by the client: z{{ |zz؏Ǣӣ$gXs?_Rʗxh؏XßbRC3#l6ޜz2֛F˚v!ЙeT@, ӤäwG3[|͞rociX cD%ޢԘĘ<ГH8xДߕ$ϕhX3003;Q23_h6*D./ !...%4ld items in the session cache %4ld client connects (SSL_connect()) %4ld client renegotiates (SSL_connect()) %4ld client connects that finished %4ld server accepts (SSL_accept()) %4ld server renegotiates (SSL_accept()) %4ld server accepts that finished %4ld cache full overflows (%ld allowed) Error setting session id context Error clearing SSL connection Error waiting for client response HTTP/1.0 200 ok Content-type: text/html Ciphers supported in s_server binary --- Ciphers common between both SSL end points: no client certificate available HTTP/1.0 200 ok Content-type: text/plain Error opening '%s' mode='%s' Warning: sendfile requested but KTLS is not available '%s' is an invalid file name Out of memory adding to external cache Unexpected session encoding length New session added to external cache %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Error parsing -status_url argument Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can only use --stateless with TLS Can't use -early_data in combination with -rev Warning: -zerocopy_sendfile depends on -sendfile, enabling -sendfile now. Warning: -sendfile depends on -ktls, enabling -ktls now. Can't use -sendfile without -WWW or -HTTP server certificate private keysecond server certificate private keysecond certificate private keysecond server certificate chainwarning: id_prefix is too long, only one new session will be possible Setting secondary ctx parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback PSK warning: there is NO identity hint in TLSv1.3 error setting PSK identity hint to context error setting session id context Failed to initialize SRP verifier file Cannot initialize SRP verifier file "%s":ret=%d Error compressing certs on ctx Error compressing certs on ctx2 assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res))unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key Collecting connection statistics for %d seconds %d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection Now timing with session id reuse.0 connections in %ld real seconds Either -skeymgmt -or -cipher option should be specified Error creating opaque key for skeymgmt %s An opaque key identified by %s is created Key generation is the only supported operation as of now %s: Cannot use -%s together with -%s %s: Must have -signer before -inkey No operation (-encrypt|-sign|...) specified Error allocating PKCS7 object Bad input format for PKCS#7 file Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file Couldn't set input text length Couldn't insert AAD when encrypting Couldn't set cipher text length Couldn't insert AAD when decrypting SIG verify failure at count %d %4ld session cache hits %4ld session cache misses %4ld session cache timeouts %4ld callback cache hits server rev bufferCONNECTION FAILURE LOOKUP renego during accept LOOKUP renego during read CONNECTION CLOSED CLOSE(NONE)Client certificate Client raw public key Shared ciphers:%s CIPHER is %s NEXTPROTO is Reused session-id Renegotiation is DISABLED server bufferError reading early data Early data received: No early data received End of early data shutdown accept socket SSL_do_handshake -> %d Failed to initiate requestLOOKUP renego during write Write BLOCK (Async) Write BLOCK ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s Read BLOCK (Async) Read BLOCK shutting down SSL server www bufferGET GET /stats GET /renegcertSSL_renegotiate -> %d SSL_do_handshake() Retval %d
<>&%-11s:%-25s                           
GET /'%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory FILE:%s .html.php.htmError fstat '%s' Error SSL_sendfile '%s' KTLS SENDFILE '%s' OK rwrite W BLOCK GET /renegget sessionError encoding session get session bufferLookup session: cache hit Lookup session: cache miss server2.pemserver.pemCan't use -rev with DTLS Can only use -tfo with TLS server certificate chainsecond server certificateerror setting 'id_prefix' id_prefix '%s' set. Setting temp DH parameters Compressing certificates Listening for TFO localhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHERUnable to get connection startingunable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Provider: %s Key management: %s (invalid operation)Error reading S/MIME message apps/smime.cmdc2whirlpoolripemd160Error finalizing cipher loop Failed to set iv length Failed to set tag length Failed to set key and iv Failed to encrypt the data Failed to set iv Failed to set tag Failed to decrypt the data RSA sign failure ECDSA sign failure sig sign loopSIG sign failure at count %d apps/speed.cRSA verify failure ECDSA verify failure RSA encrypt failure RSA decrypt failure EdDSA sign init failure EdDSA sign failure EdDSA verify init failure EdDSA verify failure XXX     o,(G;GdE|EE\GCH3DF8FXFFF0EGAEDEEERDfDzDDDDDDC)A=AMAaAuAAAAAAABB&B:BNB^BrBBBBBBBBBC4CGCZCCUE;;;;;;;;<<"<5=M=\=p=====>>+>@>U>l>>>>>>??)?=?M?a?u????;@N@l@@@@,,, A????? @@+@A(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((::::::MMOOOOOhOPO8O OONNNMMNNNxNHN8N(NNNWJWZpWYYYYYxYW\\\\[\\\]cb eee`e@ehxhhhXhHh8h(hhhhihHbHbdehehggPg@g(ggfpfXf@f(fffeebbbbbbbbbbbbbbbbbbbbbbbbbbbbbbta apps/lib/app_provider.cRANDFILECan't load %s into RNG Can't duplicate %s apps/lib/app_x509.chexdistidpass:env:No environment variable %s file:Can't open file %s Can't open BIO for stdin %s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectiondigest bufferapps/ts.cOut of memory loadinginput-typeInternal error trying to loadError readingCould not find from %s of %shttps://http://Unable to load %s from %s %s: OK Chain: depth=%d: (untrusted)CRL via CDPcopycopyallError loading file %s Error loading directory %s Error loading store URI %s File name too long %s.%sTrueFalseRequire explicit Policy: %s AuthorityUser[CRL path] NPN buffersubjectKeyIdentifierkeyid, issuerauthorityKeyIdentifierHARNESS_OSSL_PREFIXabappending(doing something)Can't open %s, %s Can't open "%s" for %s, %s Couldn't open file or uri %s %d: %s: %s %d: %s !!! Unknown code Total found: %d %s: criterion already given. %s: subject already given. %s: issuer already given. %s: alias already given. apps/storeutl.cURIMD5Error setting public key Error signing SPKAC apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure Error getting password. cannot convert %s to OID nonce buffercould not create nonce Verification: invalid digest string extra untrusted certsFAILEDcould not create query Response has been generated. Response is not generated. calling fstat(%s)%s.attrnew DBNeed at least one user. default_srpDatabase initialised Default g and NStarting user processing Processing user "%s" List all users user "%s" reactivated. row pointersfailed to update srpvfile Password for user "%s" ok. user "%s" revoked. t User procession done. Trying to update srpvfile. Temporary srpvfile created. srpvfile updated. User errors %d. (undefined)P12TEXTNSSUnable to load %s Error reading mem buffer allocate async fdstodayParameter %s '%s' asymmetricGenerating %s key with %d bits %s: Error generating %s key %-15s %s other CRLsWarningstart dateend date NOTInvalid date format: %s explicitly set public keycertificate request inputserial# bufferapps/x509.cSHA1serial= Certificate purposes: %s%s : Yes (WARNING code=%d) No Yes CAnotBefore=notAfter=Unknown digest No extensions in certificate Invalid extension names: %s Certificate will expire Certificate will not expire Unable to write certificate b64msblobnsshttppvkesc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamespace_eqdump_unknownRFC2253onelineTypical uses: [-text] [-engine id] x`H  x H g g x @ (! iPiPNdNNDMOUTVVVVXxXVhThThT8XWWXWWV`[[\\@\]]]p]X]@]0]]]@[\hc jjjjhixi`iPijjjjkkhxk`kHk0kkhkiiii}܀̀,<tTƒҒޒПpX4xxأ+ĬDtԶįį4ܯdt Tܳ4Tl4Ld|ķ,D\|IJ4Ld|̴ $>><<<, ???, warning, fatal, ChangeCipherSpec, Alert, RecordHeader, InnerContent, ApplicationData, Handshake, Unknown (content_type=%d)%s %s%s [length %04lx]%s%s %02xdepth=%d verify error:num=%d:%s issuer= verify return:%d gost2001gost2012_256gost2012_512server nameSSL_connectSSL_acceptundefinedreadwriteSSL3 alert %s:%s:%s %s:failed in %s %s:error in %s memory full Failed getting peer address apps/lib/s_cb.cassertion failed: length != 0cookie generate bufferNOT OKNOT OK %s: %s Suite B: not tested prepend certSecurity callback: Version=%s%s=Public key missing%s, bits=%d digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d scheme=%sSRP parameters: N= g=SRP param N and g rejected. SRP username = "%s" User %s doesn't exist Shared Requested Signature Algorithms: rsa_pss_pss_sha256rsa_pss_pss_sha384rsa_pss_pss_sha512ecdsa_brainpoolP256r1_sha256ecdsa_brainpoolP384r1_sha384ecdsa_brainpoolP512r1_sha512+%s+0x%02X%s: %s: a hexadecimal0Xan octalautoEnabling auto ENGINE support dynamicSO_PATHLOADInvalid engine "%s" SET_USER_INTERFACECannot use engine "%s" Engine "%s" set. apps/lib/engine.cConnection: keep-alive sending response header: %s{ }apps/lib/opt.c%s: Bad format "%s" B64BASE64p12PKCS12%s XTS ciphers not supported assertion failed: vpm != NULL%s: Invalid Policy %s %s: Invalid purpose %s %s: Invalid verify name %s %s: Option -%s needs a value %s: Not a directory: %s %s: Unknown option: -%s %s: Missing argument: %s %s: Extra option: "%s" (No additional info)-*Usage: %s [options] Valid options are: Parameters: %s %s error setting certificate error setting private key Missing filename Server Certificateserver keyserver chain%s: Error adding xcert %s: Key already specified %s: Chain already specified signed the peermatched the TAmatched the EEVerification: OK Verified peername: %s Verification error: %s TLSA hex data buffer0123456789abcdefDANE TLSA %d %d %d %s%s %s certificate at depth %d Error finishing context Error writing keylog file %s %s:%s [%s]:%sACCEPTunknown:error PID=%d*:%sInvalid verbosity level %derror setting up accept BIOerror printing ACCEPT stringapps/lib/apps_ui.cUser interface error aborted! SRP password bufferSRP userapps/lib/tlssrp_depr.cLOOKUP done %s LOOKUP not successful %s [%s]:salt bufferrounds=%u%s %s unknown typeintegerUTF8 encoded stringoctet stringunsigned pointer to a pointer to an %*s%s: [%d] (arbitrary size) (max %zu bytes large)%*s %s [Success]: %s [Failure]: %s Unable to rename %s to %s %s.attr.%sUnable to open '%s' unique_subject = %s invalid revocation date %s missing hold instruction invalid object identifier %s missing compromised time invalid compromised time %s invalid reason code %s %s: Out of memory ExpiredRevokedValidundefPRINTABLE:'T61STRING:'IA5STRING:'UNIVERSALSTRING:'ASN.1 %2d:'\0x%02X^%coptionalsuppliedmatchType :%s Was revoked on:%s Expires on :%s Serial Number :%s File name :%s Subject Name :%s Certificate Details: (%ld days)Sign the certificate? [y/n]:row expdaterow spacecertificate requestError unpacking public key Negotiated TLS1.3 group: %s Peer Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits groups to printSupported groups: Shared groups: ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)Protocol version: %s assertion failed: num == 2Client cipher list: Ciphersuite: %s Peer certificate: Hash used: %s Signature type: %s Peer used raw public key Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s HTTP/1.0 %d %s GET or cannot get port listening onawaiting next request ...request line read errorBad Request HTTP/1.error reading HTTP headerConnectionkeep-aliveclosePOST received request header:%s "%s" %d = "%s" , , %s, %s, Iteration %ld, PRF %s, Iteration %ldKey bag Bag AttributesKey AttributesShrouded Keybag: Certificate bag Secret bag Bag Type: Bag Value: Safe Contents bag RSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 SignSHA224SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512gostr34102001gostr34102012_256gostr34102012_512Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate Typemax fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzsupported_groupsEC point formatsSRPuse SRTPsession ticketrenegotiation infosigned certificate timestampsclient cert typeserver cert typeTLS paddingnext protocolencrypt-then-macextended master secretcompress certificatekey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, CompressedCertificate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad)HHHHHHHH8HH8HHHHHHHHHHHHHHHHHHHHHHHHHHHH`xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxB..jH0XXXXXXXXXXXXXXhh(hH(PhH(hH(      +  t <<<< %zu (0x%zX)) read from %p [%p] (%zu bytes => %d) write to %p [%p] (%zu bytes => %zu (0x%zX)) write to %p [%p] (%zu bytes => %d) error setting random cookie secret Error calculating HMAC-SHA1 of buffer with secret Checking cert chain %d: Subject: s_cb.c:security_callback_debug op=0x%xSRP param N and g are not known params, going to check deeper. SRP parameters set: username = "%s" info="%s" %s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number No engine specified for loading %s No engine key id specified for loading %s HTTP/1.0 200 OK %sContent-type: %s Content-Length: %d sending response, 1st line: %.*sassertion failed: unknown_name != NULLassertion failed: unknown == NULLassertion failed: unknown->valtype == 0 || unknown->valtype == '-'%s: AEAD ciphers not supported assertion failed: opt > OPT_V__FIRSTassertion failed: opt < OPT_V__LAST%s: Internal error adding Policy %s %s: Internal error setting purpose %s %s: Option -%s does not take a value %s: Non-positive number "%s" for option -%s %s: Negative number "%s" for option -%s %s: Invalid format "%s" for option -%s %s: Multiple %s or unknown options: -%s and -%s %s: Extra argument after %s: "%s" %s: Extra (unknown) options: "%s" "%s" error setting certificate chain error building certificate chain %s: Error initialising xcert %s: %zu-byte buffer too large to hexencode matched the peer raw public key Call to SSL_CONF_cmd(%s, %s) failed # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names Secure Renegotiation IS%s supported This TLS version forbids renegotiation. error setting accept on port %sCould not allocate %d bytes for %s Missing newline at end of input String too short, must be at least %d bytes long String too long, must be at most %d bytes long Warning: truncating password to %u characters [Error]: internal stack error [Error]: command name too long Error creating random number to store in %s Unable to load number from %s Error converting number from bin to BIGNUM %s: %s name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Error copying %s name input %s: Missing '=' after RDN type string '%s' in %s name string %s: Escape character at end of %s name string %s warning: Skipping unknown %s name attribute "%s" %s hint: a '+' in a value string needs be escaped using '\' else a new member of a multi-valued RDN is expected %s warning: No value provided for %s name attribute "%s", skipped %s: Error adding %s name attribute "/%s=%s" invalid type, Database error The Subject's Distinguished Name is as follows emailAddress type needs to be of type IA5STRING The string contains characters that are illegal for the ASN.1 type %s:unknown object type in 'policy' configuration The %s field needed to be supplied and was missing The mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Extra configuration file found Error adding certificate extensions from extfile section %s Successfully added extensions from file. Error adding certificate extensions from config section %s Successfully added extensions from config ERROR: adding extensions from request The subject name appears to be ok, checking database for clashes ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption Certificate is to be certified until CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED The matching entry has the following details Certificate request and CA private key do not match Signature verification problems... Signature did not match the certificate request Supported Elliptic Curve Point Formats: No peer certificate or raw public key awaiting new connection on port %s ...cannot parse HTTP header: missing end of lineinvalid %s -- URL does not begin with '/': %sinvalid %s -- bad HTTP/version string: %sinvalid %s request -- bad URL encoding: %scould not allocate base64 bio with size = %dHTTP request does not begin with %sPOST: %serror parsing HTTP header: missing end of lineerror parsing HTTP header: missing ':'error parsing DER-encoded request contentout of memory allocating %zu bytesreceived request, 1st line: %s, Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ldWarning unsupported bag type: application layer protocol negotiation bad_certificate_status_response ;LqPB5BQJhJKK 0MMRPT` UVpW,Wx]0^0aaPl@0uw```D4<0hPH P `px$%@% &@&'''* (.(/)0,)0t)1)@2*2H*g*Pt0+ z|+ {+0~8,,Є, - .@l..p/h//05x5550 6p666(7x7p7H8|8 *8p+9/x9197:7<:@8d:8:;;<8;`<`;<;?< @<<@<PC<C=0D`=F=@G=GH> K>pK>L ?Np?`N?N?QH@PQp@Q@TAT0AU|AUA`VAXTB0YB`YBYB@ZC\|C\C`]C_TD_|D`Db,EeEeE0fEgTFFGhGG8HLH `H0tH@H`HH8I LI0`IPtIIII4JJ0JhHX>oBBM E(A0D8J 8D0A(B BBBK >3FBB B(A0A8G L" 8D0A(B BBBF 6 "G"^"B""G"^"A"q"T"I"B"S""G"h"A"l"B"["A"Z"M"B"G"["Hh?FEE B(D0H8N` 8D0A(B BBBC H?8FBB I(K0C8Ipb 8D0A(B BBBG H@BEE N(D0D8MP 8D0A(B BBBE PL@0LBBB B(A0A8G I  8A0A(B BBBF @,FBE B(D0D8GHLBAIADBFAEBDQF 8D0A(B BBBF <,A/FBB E(D0A8G 8A0A(B BBBF IBIQ\BBBBBISKBAN^BBBBBIQ`QZBO\BINZAZHGHqOfBYLBI[A0lB/FBB I(D0A8LLBFBB E(A0H8G3 8A0A(B BBBD B< 9FBA D(DG (M ABBF Q (M ABBM  (A ABBH ^ (C HBBK z (I HBBE pxC FBB B(A0A8GnCcBzVbA 8A0A(B BBBD C@D<D8(D4FDB B(A0D8DP 8D0A(B BBBI tKdFBB B(D0A8G 8D0A(B BBBG EBFNGBEbH0L]FBE B(D0D8GPM 8D0A(B BBBH (|LBFD KKHLtFLB G(D0O (C BBBI A(F BBB$LoFAD ]DBTMFEE E(D0C8GPe 8A0A(B BBBF kXS`PXAPHtMhFQB B(A0A8KP 8F0A(B BBBG TMKBBA A(G L@I@@H@V@A@ (A ABBF LN `FBB B(D0A8I 8D0A(B BBBD LhN$FNB B(A0A8J 8F0A(B BBBG HNd+KFLI B(G0A8DP 8C0A(B BBBK 8Oh-FBA A(D@ (A ABBA H@O .FEB B(A0A8DP 8A0A(B BBBA O.CA}O.[7FBB E(H0C8G 8D0A(B BBBE HmAIHBGqOnB)NQEI N`B8XPeBED A(G@ (D ABBK dPf FBB B(A0A8G L@LA\ 8D0A(B BBBJ aAHA^AAAHPqFBE I(D0C8Kp 8D0A(B BBBG HHQDvKFBI H(A0C8K` 8D0A(B BBBE $QHz;FGG `DB\Q`zFBB E(A0C8G 8D0A(B BBBG FfAR(H_4RؗHR\RpRRRR R,R8RDRP SL $SH 8SD 4LS@FAA v ABG GAE4SFHA i ABE GAE@SFBB A(A0D@~ 0D(A BBBG HT$FBB B(A0A8DP 8D0A(B BBBA LLTFBB B(A0A8DB 8D0A(B BBBA HTFBB B(A0A8D@ 8D0A(B BBBA HTFBB B(A0A8D@ 8D0A(B BBBA H4UFBB B(A0A8D@ 8D0A(B BBBA @UoFNB A(A0Dp 0D(A BBBI HUءFBB H(A0l (D BBBG h(D LBBHV\FBB H(A0t (D BBBG h(D LBBH\VFBB H(A0t (D BBBG h(D LBB@V FFB A(A0D` 0D(A BBBJ HVPFBB B(A0A8D@ 8D0A(B BBBA H8WFBB B(A0A8DP 8D0A(B BBBB 8WFBA A(D@ (D ABBA 4W FBA A(D0h(D ABBLWTFBB H(A0 (D BBBK f (D LBBF LHXFBB H(A0 (D BBBJ f (D LBBF 0XħFAA D0  DABA 0XPFAA D0  DABA @YܨFBB A(A0DP 0D(A BBBC HDYxFBB B(A0A8DP 8D0A(B BBBC (Y ECD`N AAD (YFAD0{ DBD (YFAD0{ DBD HZhFEE K(N0d (C BBBJ A(F BBB(`Z̫ZFDA CAJ4ZFED F0  DBBJ @ZBAD l ABJ V CBE aCB<[BHD D0  AABI k AABLH[BBE B(A0A8GG 8A0A(B BBBK 0[TUBAA G@  DABD $[AEAG gDD[ $\AEAG gDD0\̴ D\ȴ]GG`\ ^GH|\P^GHP\ϙFLH I(D0C8I 8A0A(B BBBA \O] O]O6(]DO,<]POBAA d ABE Xl]OBEB G(D0A8J  8D0A(B BBBH D N S A H]4QgBBE E(D0A8O  8D0A(B BBBG @^XRBDC G0Y  AABC r  JABI 0X^RBGD G  AABA 0^pSXBEA G  DBBE 4^TFEA X BBH EBBH^$UFEE I(D0H8Ip 8D0A(B BBBG 0D_XXBAG o KDH DABx_X 4_XRFAD r ABH AFBP_XOED A(G0m (F ABBH n (C ABBJ PP`TYOED A(G0m (F ABBH n (C ABBJ P(l`YWBGA vII\`YBBB H(D0D8F@X 8A0A(B BBBB D8G0H(B BBB`4Z a@Z 0 aFBB H(A0H8F@ 8D0A(B BBBA $caEU F Y O WHcHbGFIH B(A0A8O` 8D0A(B BBBH LdLcFHD D0b  AEBH s  ABBH ^  ABBE PPdcFIA PS  DABF v  IHBG ^  KHBM LdgFEA D(G0L (A ABBG L (A ABBA (dhFLH ^ BBA H e|hdFEE D(G0f (D BBBE I(D BBB0lehFGA G0Q  DBBB \e\iFBA D(D0 (D ABBB a (D ABBF O (A DBBH f jEAG(fjJFQG N BBA HHfjBBB A(A0G I % 0D(A BBBH (fXlEDD P AAA tfl FEB B(A0A8JOYB 8D0A(B BBBK OIAV\8g$y,FEE E(D0G@NHKPKXB`FhBpBxBN@T 0A(B BBBC HgyUBBG B(A0A8DpB 8D0A(B BBBF Tg},FEE D(G@NHJPOXB`BhBpBxBN@T (A BBBK `FBB A(D0 (D BBBB \ (D BBBJ >pLDD L ?FBB E(D0C8IK 8A0A(B BBBD H0@WFHH G(D0D8Js 8C0A(B BBBB `|AFBB B(D0G8DP| 8A0A(B BBBG D 8M0A(B BBBN s` j?s` l @s0a jAspa lBsa Csb Xb | D-b - 0_ Esb Fs(c pV Gspc Hsc  Isc @d - Bsd Asd Dse Cs0e -  s`e  >e - 8 -e A sf J sPf R sf ^ sf h sg Xg t sg -g } -g p8h sh -h si s@i si si -j - j sHj Nj sj s k s spk ( sk 4 sk @ sl N sXl W sl ` sl (m h s`m t sm | sm sn s@n sn sn No N`o -o No noN0p Nxp  sp  -p  -(q , -`q q q < -8r O -pr a -r -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u S -Y -w ܊ -_ -h 5 -@u g -  -  shu -u \- +e - Fe -u ee -u e -u  -v N -8v  shv - Bsd Asd Dse Cs0e P -6^s\ v    & 9 D Y i ) !  w        @        & 0 S -v -w ܊ -_  -v ` 5-w 9 /@ X <Y s F0w z *-pw ܒ >w  sw  -x } -  "-0x  +<hx  ,<x  sx - ^ s [ sx Is  s -  s y  -Hy " -xy  4-y 0 -y X sz ? (sJ z sPz b )sl  pz l /sz  0<{  -  -@{ -l ir sh{ ? s pV f{ n s{ js| H< 0_ F`|  -| #t s|  s| -  !- H.s} z 1sP}  2- 8 3s} @ Fs$ K Gs} T Hs~ c IsH~ u #s~  $s~  %p   &p@  'p` -< -  s`e  >e - Bsd Asd Dse Cs0e P -6^  -w ܊ -_  < - s A X < ܒ >   ! p( k p9 S p \ s@ h c s k  u sz  - wU    p S -0 -w ܊ -_  s` -s X < s F -h ܒ > F -ב  -  - ` - - -  s`e  >e - Bsd Asd Dse Cs0e P -6^% - н -w ܊ -_ $O -6 K -( V -X _ -h  s` -s X s s f - n s -h ܒ > f  -̒ - Am -  -ؾ  s - Bsd Asd Dse Cs0e S - -w ܊ -_ J - 8 -8  s` -s X < s FA -h ܒ > FZ -h  - e - mq -  -  - ` - -  s`e  >e - Bsd Asd Dse Cs0e P -6^% X S - -w ܊ -_ ܄ -t  s` - n s -h  - p - ܒ >8 pV f` ޅ - - p U -“ Xa -“ -l e - Bsd Asd Dse Cs0e P -6^  -w ܊ -_ -s X < s F e -@ k <p -h ܒ > F - Bsd Asd Dse Cs0e -w ܊ -_ k-t -s X < s F j< pV F -h ܒ > F  sw -0 Y -ݔ `U -P sx $O -? - K- y -  -)  -> Z -L  -f w - ~ < - / <@ :p - - - - Bsd Asd Dse Cs0e S -X ܊ -_ -w X < ܒ > ^ F<x - _- S-ʕ s l Hsp pV Gf  Ps` - Bsd Asd Dse Cs0e -  s`e  >e - s ֗ C<ܗ . $O -0 " Osh K-  L-' > M-J a N-k - -l ir Es t Bs k 0< 8 Ș - Θ -ט - - !-  "-@  --` ( .- > Is S Js -f t sX  7< } &- '- %- -0 -X Ș - - 1<ƙ 2/ 3: 5- 4- 6- -h $- =s - F D>" h ?s: h @sE Z AsR -Z  +-@  8- 9s m ,- -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u -w ܊ -_ X <` n s - %T &- -8  ?sh s f0w  s js /T s7T pV E ܒ >DT f@ aT C-p  5- - '-  sw hT s Z ,-H T 9-pT zV "-T X /-T z 0-T V --p Z *-T K+- sx R -T Y (- T (- U $U =- 5U )-AU YU >- l Fs( iU <-` pU !-yU  .- @V %- Am $-U - U 1M @ U 2sh U 3s U 4s -U U s U #- ? Esz b FsPz  n0 V D-x V s .V s  s#V :V < GV ;-@  < l s #t s w @- $O A-P -NV Q< aV F hV s nV E xV sP V :- - V 6- V s V 7-V V s8 V 8-` V s -  s`e  >e  Bsx - Bsd Asd Dse Cs0e -w ܊ -_ -h o -V }-V U -W Dr -W 6 -5W -LW  - p -eW p -W 5 -W  -W S -X -w ܊ -_  sx  - sx -W t <0 <0 /P : - - - D <h W < W - W - -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u  s| - Bsd Asd Dse Cs0e P -6^HH -w ܊ -_ ^ <X Is  sx s t sX CX </X <IX /dX :}X D <X X -X X -X n s $O -? -X Y -X p <Y jsY 7Y <AY H -\Y X < -xY k-Y Y -Y Y sY Y -Y ܒ > -Y -  s`e  >e -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u - Bsd Asd Dse Cs0e S -Z -w ܊ -_ $O -?  sx -Z ^X --Z k -JZ _Z -dZ Z syZ K s zV s Z s0 T sZ p -Z -s n s -h ܒ >DT -`  -Z - Bsd Asd Dse Cs0e P -6^uU Z S - -w ܊ -_  -Z ^ < [ s  sx -[ >t -[ /[ - 6[ - ܄ -=[ - H[ <Q[ jh s l[ sP n s  s -  s`e  >e - Bsd Asd Dse Cs0e P -6^`x -w ܊ -_ u[ s  sx -s X < j< pV f{ n s }[ s[  s[ -h js ܒ >  -[ @V -[ k-[ - Bsd Asd Dse Cs0e S -8 -w ܊ -_ [ - [ - p[ \ p  sx GpH \ L-p \ M- ^ F<x -%\ 9\ s  s=\ Y\ Ks^\ S- z\ J- \ N-\ | O-X -\ \ -x 4v Hp Ip \ p -  s`e  >e - Bsd Asd Dse Cs0e P -6^v @ S -X -w ܊ -_ X < s c ܒ > c s@ pV f  sx 1 - : -( 8 -@ ^ F<x -[ _- S-ʕ e -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u - Bsd Asd Dse Cs0e P -6^H -w ܊ -_ ] Gs %] Hs I-P s\ Fsx - Bsd Asd Dse Cs0e -w ܊ -_ A] s.] -s X s s F -h ܒ >DT f -I] H-f]  - -w ܊ -_ -z] Xs -] ] -] ] -] s\ s  sX +e -] Fe -] ee - ^ e -^ kp  p +^ s - sx H< j<0 /^ <6^ <6^ /N^ :k^ - - -` - Bsd Asd Dse Cs0e -w ܊ -_ ^ Ts ^ @-^  sx -^ j p Xs ^ sp ^ - -^  -^ -^ A] s^ )<6^ /N^ -:k^ *- - .-` aT - k n Gn n sx H<@ _ i<x 0_ F :_ < _ (-( _ sH jsp *_ j< pV f g s( l <X /_ F 9_ < E_ < J_ fH S_ s Y_ <a_ i gs {_ h- _ 2- c D-H ` E-_ _ H-p +^ P- _ Q- _ {- _ 6-8 _ R-` _ fs _ os _ pp N < ` ` %F W -H %` +< 1` !/ =` /: J` ,<@ W` "/x d` 0: r` #-{` ` $- ` &-( ` '-P ` 3-x ` 4-` e - -` z 7- ` 8- ` 9n( a <sa :sP ;sW W 3a =< -?a Oa A- ^a B- ua F-0 DSO-p Xa 5-{a a >-a a ?> O C-a a S-a a Wp a p( a q> b -^ #b 1-(b b-c Yc un hc v-0 ec w-` tc y- c z- c e-c +e ]-c Fe \-c ee [-c e Z-c c ^-d d d- d _-#d 4d `-e -d e -e (e -0e Ce -Me be -le e -e ] -] e - e -e e -0 e -` e - e - e - f - p -%f Zf -8 @f -x Wf - pf - f -( f -x 2 - f s f s Q} s JJ s f s s\ s  sX f s f sP f s f - f - g - g -8 -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u -h g <g =g < Cg < Jg - Wg F ag F@ - Bsd Asd Dse Cs0e S - -w ܊ -_  $sx jg s ^ 4s -  |g -X g <g -^ x sg j pg Xs g s s g s g s( ^ sP -^  -^ g ]p |b ^pb lb _p a `p cb apP g -g -^ H < 0_ F :_ B<8 _ E-h jCs pV @E g As( k p sx H/N^ L<6^ P:k^ M- I- Q- h d< h s h 6h s Gh - ,q+s]h  ,sb c -< [ \sX -jh |h D- h >h h <h -h c -H ` -h ` - ` -h i Us i sX ua -0 %i - ,i - -?a ;i (- Xa -Ei a "-a a #> _ )-Ri O *-li _ Zs _ [p Oa &-( ^a '-H ^ %-p a b> b i - i -i i Vs i W- _ -8 _ - z - _ Ts@ d Gs a X- #b -(b -@ +e 8-i Fe 7-] ee 6- ^ e 5-^ c 9-i i <-i >- Lb ?pi d :-i 4d ;-j Od =-Td ]d -ld d Fs0 nc<!j e -d e -e (e -0e Ce -Me be -le e -e ] -] e - e -e e -0 e -` e - e - e - f - p -%f Zf -8 @f -x Wf - pf - f -( f -x 2 - f s f s Q} s JJ s f s s\ s  sX f s f sP f s f - f - g - g -8 -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u N < ` W - ` F ` -( ` - %` N< 1` J/( =` R:h J` O<@ W` K/ d` S: -h g <g =g < Cg < Jg - Wg F ag F@ - Bsd Asd Dse Cs0e P -6^j  -w ܊ -_ j -j k - k - k #k -(k 8k -8 Bk -Jk -  s`e  >e - Bsd Asd Dse Cs0e -w ܊ -_ J -Zk $O -6  sx -s X s s fp - qk -k n s -h ܒ > f  -k k -k  s  -̒ - Am -U k F- -k K -( V -X _ -h - Bsd Asd Dse Cs0e -w ܊ -_ s\ s  sx k s X <P s F0w k- - -l ^ < l I2s  - sx #l s*l "-Gl \l #- al $-@ Q%<p hV &s hl  s Z !- 0 '-y ? (sz b )sPz  *p@ U +sl  ,sh l -s .sl l /s l 0-( -l js` pV f` @V -[ >l n s  s s l s #t s|  s| $O 1-? -h ܒ > F } -0  - ` 3- l -m m -`  -$m 6m - Am -=m -  s`e  >e - Bsd Asd Dse Cs0e S - -w ܊ -_ ' -_ Im - e - ˒ -Pm -h 5 - - Bsd Asd Dse Cs0e P -6^W 0 S -` -w ܊ -_  sx -h ܒ > AK -mm ޅ -m -  s`e  >e - Bsd Asd Dse Cs0e P -6^} m S - -w ܊ -_ m pm m pm -h ޅ -m m -m m - - Bsd Asd Dse Cs0e P -6^p -w ܊ -_  sx -! DT n H>" 8k -" Bk -Jk sn -@# -# n K-# jLs# l s n sP$ n sn n pn n Is$ -  s`e  >e - Bsd Asd Dse Cs0e -w ܊ -_  sx J -n -s X < -h ܒ > -n  -$ - Bsd Asd Dse Cs0e -w ܊ -_  sx - Bsd Asd Dse Cs0e J - o o -)o -s X s s f n sFo -$ -h ܒ >% FH% $O -p%  s% k -%  -&  -0& -X& co -& lo s& yo s& -w ܊ -_  sx 7J so o so o s' -s X < s Fo n s o -H' -h ܒ > Fo p -p  s k -p' qr pp r -6p r p' ' -Op `p -gp |p sp p sp p sp -  s`e  >e - Bsd Asd Dse Cs0e -w ܊ -_  sx -s X < s F -h F ܒ >  -p -'  -( p -@( ` -x( - Bsd Asd Dse Cs0e -w ܊ -_ X #< ܒ $> n %s  &s 's( q -( q -q -+q  -) Eq I-H)  .sx - Bsd Asd Dse Cs0e -  s`e  >e -) Γ -) Lq -Uq pq -) xq -q $O -* l -m m -` -0* _ -q sX* k <* q s* CX -* + D <P+ )<q (/q *:k^ ,- +- -- [ sq r "s+ r !sr &r -+ *r -+ 0r -, 7r s0, >r s`, ` -, Fr s, Mr G- - [r HsH- qr px- r -- lr -vr nr -- r pr r -r r Fs. S -H. -w ܊ -_ -s X <r -h. s -r -h ` - s )s -s /s -7s -Ls qs sds  -.  -. vs -. ]q-{s s -/ -  s`e  >e - Bsd Asd Dse Cs0e P -6^ 8/ -w ܊ -_ s -`/ !<ƙ "< #: $- %- &- -s p/ s -/ p0 s -00 w -h0 Q1<q s 2p0 s 3p0 s1 t <01 s <X1 s 0<s t 4p1 t 5<1 ]n 6<1 n ;s2 t 7<82 t 8sh2 "t 9s2 f:s*t Bt <s2 $O -3 -Gt a sXt x s83 j Nft ,st sP sW W ܒ >t -t Y -t Y -`3 t -3 t -3 u -3 -3 u -u 5u -?u [u -du u - 4 u -X4 u -4 u -4 u s4 u <u u < 5 H.<P5 zV /s5 u 'u5 /T )s5 *s6 u +s86 K-<v v (pv -s  sr  s  s  n  ns  M  s  7 sD X sb { -(s  -  -Ps  -  -  -xs  -s ! -s - -t 9 -F c -n } -0t  -  -Xt  -  -t  -  -t + - 9 -t G -u - Bsd Asd Dse Cs0e -w ܊ -_ -s X < -h - Bsd Asd Dse Cs0e S -Zv -w ܊ -_ 8 sh6 s\ sxv jsv -6 -s X <6 -h ܒ >8 -6 - Bsd Asd Dse Cs0e P -6^v v S - 7 -w ܊ -_ P -6^v H7 -w ܊ -_ v -x7 k -7 v <7 v sv v s7 v -(8 v -8 w --8 w .-8 1w -09 ;w -Hw bw -h9 |w -9 w -w w -w 1x -w x -9 x -: /x -(: Cx -Vx tx -H: x !-x x "-h: x -: x -: x -; y #-y )y $-9y Ty %-(; hy &-{y y '-y y (-y y )-z z *-2z Oz +-H; kz ,-p; -s X <; -h ܒ >; v s8 s; 6  -< z s8< z sz ^ <z ` -z -w ܊ -_ -h ]q-z  -{ { s{ -3{ M{ -3{ _{ -n{ { -`< { -< { -< { -< { -@= { -h= { -= | -= { -| | -#| R| -<| Q| -= _| -> \ -(> | -w| | -X> | -> | -| | - } %} -3} M} -> I} -> ee !-? e "-X? X} -b} } #-} y -} W s? } -? - Bsd Asd Dse Cs0e S -J -w ܊ -_ h s? s\ sxv jsv lsr - @ o sP@ -h ܒ >8 -6 - Bsd Asd Dse Cs0e P -6^v  -w ܊ -_ -h -x@ -@ -@ -@ -˂ - -  -W ( -7 S -O -w ܊ -_  sx -s mq- A l -HA o -HA -h ܒ >A  s pr  - ` - k F- $O -A -  s`e  >e - Bsd Asd Dse Cs0e P -6^% -w ܊ -_  sx < v s  -A ` -B l s0B ^ <x -h ܒ >҃ > F g s ( -1 -N $O -hB - Bsd Asd Dse Cs0e -  s`e  >e S B S -B -w ܊ -_  sx -h ܒ >B  s -  s`e  >e - Bsd Asd Dse Cs0e $O -A  - ` - P -6^l C S -@C -w ܊ -_ P -6^z S -`C -w ܊ -_ -C sC sC -h 5 d-D e-PD f-xD g-D  -D -D (E P -6^ -w ܊ -_ ܄ -Ą  -ф Dr - U - p - J-  sx -s X < ] s ' <- -h ܒ > g sG 5 - o-XE AK -Y H-E -\ k -E qs -q - Xa -“ s (r sŅ  sՅ s ir sE qr p0F Tr -hF F c - r pF 6l-G ] Fs@G %] GsG $O -6 -  s`e  >e - Bsd Asd Dse Cs0e -w ܊ -_ ) -G  sx -5 X <E s F ܒ >DT F -h -G  -a |o sH - J - -HH -H [ sH oo sH -  s`e  >e - Bsd Asd Dse Cs0e -w ܊ -_  sx -s X s s fp - n s J -† $O -6 |o sH oo sH -h ܒ > F  -̒ -؆ - I  -ؾ -HI  s - Bsd Asd Dse Cs0e R V B $O p             " f f{g hij ?@@r !  >`` `- @ @!<y ]fox   o "0> f {x~ |~ s  h8[#i L~  Ȁ ~   $ S u   Ӏ * ߀ _ À  ݁ >׀ ! ڀ SG MU_ YaiqyRRRRR R R@RRRIm R SS3SASHS``PS`VS `\  @`\SeSrSzS7S Xkkkklll+ll 8l Il Zl | ^lgl#vllllllt3ll m m3*m+ )=m-Km/cm1n*co~  KKo L I`9& oo8ooD+oG0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p   0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p          0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p   0 @ P ` p         !! !0!@!P!`!p!!!!!!!!!"" "0"@"P"`"p"""""""""## #0#@#P#`#p#########$$ $0$@$P$`$p$$$$$$$$$%% %0%@%P%`%p%%%%%%%%%&& &0&@&P&`&p&&&&&&&&&'' '0'@'P'`'p'''''''''(( (0(@(P(`(p((((((((()) )0)@)P)`)p)))))))))** *0*@*P*`*p*********++ +0+@+P+`+p+++++++++,, ,0,@,P,`,p,,,,,,,,,-- -0-@-P-`-p---------.. .0.@.P.`.p.........// /0/@/P/`/p/////////00 000@0P0`0p00000000011 101@1P1`1p11111111122 202@2P2`2p22222222233 303@3P3`3p33333333344 404@4P4`4p44444444455 505@5P5`5p55555555566 606@6P6`6p66666666677 707@7P7`7p77777777788 808@8P8`8p88888888899 909@9P9`9p999999999:: :0:@:P:`:p:::::::::;; ;0;@;P;`;p;;;;;;;;;<< <0<@<P<`<p<<<<<<<<<== =0=@=P=`=p=========>> >0>@>P>`>p>>>>>>>>>?? ?0?@?P?`?p?????????@@ @0@@@P@`@p@@@@@@@@@AA A0A@APA`ApAAAAAAAAABB B0B@BPB`BpBBBBBBBBBCC C0C@CPC`CpCCCCCCCCCDD D0D@DPD`DpDDDDDDDDDEE E0E@EPE`EpEEEEEEEEEFF F0F@FPF`FpFFFFFFFFFGG G0G@GPG`GpGGGGGGGGGHH H0H@HPH`HpHHHHHHHHHII I0I@IPI`IpIIIIIIIIIJJ J0J@JPJ`JpJJJJJJJJJKK K0K@KPK`KpKKKKKKKKKLL L0L@LPL`LpLLLLLLLLLMM M0M@MPM`MpMMMMMMMMMNN N0N@NPN`NpNNNNNNNNNOO O0O@OPO`OpOOOOOOOOOPP P0P@PPP`PpPPPPPPPPPQQ Q0Q@QPQ`QpQQQQQQQQQRR R0R@RPR`RpRRRRRRRRRSS S0S@SPS`SpSSSSSSSSSTT T0T@TPT`TpTTTTTTTTTUU U0U@UPU`UpUUUUUUUUUVV V0V@VPV`VpVVVVVVVVVWW W0W@WPW`WpWWWWWWWWWXX X0X@XPX`XpXXXXXXXXXYY Y0Y@YPY`YpYYYYYYYYYZZ Z0Z@ZPZ`ZpZZZZZZZZZ[[ [0[@[P[`[p[[[[[[[[[\\ \0\@\P\`\p\\\\\\\\\]] ]0]@]P]`]p]]]]]]]]]^^ ^0^@^P^`^p^^^^^^^^^__ _0_@_P_`_p_________`` `0`@`P```p`````````aa a0a@aPa`apaaaaaaaaabb b0b@bPb`bpbbbbbbbbbcc c0c@cPc`cpcccccccccdd d0d@dPd`dpdddddddddee e0e@ePe`epeeeeeeeeeff f0f@fPf`fpfffffffffgg g0g@gPg`gpggggggggghh h0h@hPh`hphhhF 0F 0R 0_ 0h 0q 0z 0 0 0 0 0 0 0 0 0ǁ 0ҁ 0݁ 0 0 0 0 0 0 0 0! 0* 02 0: 0B 0f u   " f u   " f u   " d ܊ asn1=SEQUENCE:LDAPMessage [LDAPMessage] messageID=INTEGER:1 extendedReq=EXPLICIT:23A,IMPLICIT:0C,FORMAT:ASCII,OCT:1.3.6.1.4.1.1466.20037        p  0!?܌`0&9>dQ'^v͆3;<~ w"0qt035V4Go;X ܏pAzҚ5 W wTt>O|Lfέ=P!mĮ8bl ي] {1;VhU t WmNXOXWt|K]DX .Lr"]+-`V+!9X7ʣwn3m_3.4B_ <'~݇UiUzq]:xC)I^yG.c礋TD]c,~e% O:J褃Ix߬,7>yU؜l[z[[us'y(EX#l)PQ8L5{0^t?.3tu Oeo7ͶoP^}ֻ@Ն&A>s*M\-j(uL#,re<%? Nnzzy0 -d tHN5PD0Jmk.5R&7 o{@bo]/; hitCJrl.4^v>EJzg81{T Xٔ]^PkW*];)!AG UMp⊊#6)TfX }]lHS+G4>?VCeZp>b?[P]gb)m]W 2j5](Ą%c>0WE4:wa=J]yK/%(iw|Ju.+P2COw" iX 5maJenbj9 ANHs/U7kE.&c"^ͮbN-iOA~6)Y7d@2&0`nԳD3LJǒB6>tcY 6E+6^ʫIӫc W<I]^#8 "]V2nic'NXpNl^jCElf\}\xU3K<;XyjSiWq[BI薀H|t~kT75{9O.ev XWn?L-F(:H峄GXŬ#͖^A{KS ImQم:b1\nM{QY\̭˓iqc3;#z=ok[ښٕv8ӽJpM‘MT,ߪw(*,|& QMvvEOvq,T ouMʓH0J%/I25 IBљ#*!Q'*I ϞD'A W6\~t+_j3,*'Wj@OL:].꽂^Cqշx:D&eSVODUG?B߼ iT[|IϿBOd儇 p%8ӴxO?NKsz{w,å12U5wbFa00ࢌ)D_MR("6eT_- Nۤ/7A)G7Z?AIWΠ??FtS0Mnrsy`.*}|MD؊P):)ٯ:G]33[J_[88^΁DfbdOv#ak÷3cx2; Xꭼw1Y% .b\hv#E P?Þ;TU2tF,~` {9Z qE9MڍDH1%GۘVfHLl,TCvvh oՓʛ0a ʙ/fVJ.4U+J|gmk[́\:6zдW&e=;<IJM1^O=f"}Ư<>oz/̍"(%ԔӪЅo Ur >4, E'/U>xx.әl?v:0v0JPXԹ4BNGTEeKЅS~Y Wj؟w@c!uv'A0_Ƥ0S6.ٕ)F`'o>1*N|.AO#!MtD9iK.v^De1 ,g=.ӗTES|?ɬ kr$BCR-Ӊ(vUg9ٷ jQz:;A[]3hSdÊFDloEg<"Gzy znS옂W8U:Mr7J6T?g׸nO`+Z Q30F&8ɗ2-Y8ffN{c?ҭB) (YX}\C~ c-a3QFCNa(epC!v{@'>kwmΚw١@k!ܖrϕ^%`9Tlu88MB%f V&MXqjܐ6nC,NfcHо$#.0;/3x n3' 71MC̠I-7Ӑ_1iK석+ݛX((Tl% OG®/m)=(CLyYuwVCڬBʕs&T:7d1@YrMa!BLx1|{jT8T/ڟyBʺ!+JN5=Ů'0E;C>5 S2+]XҫSeIHM]`EJ`+7c XC~ܡV^i0~v_Xϻn2Ho|ȏӆ"Iܒ Mvg@[TfHYU;췈0rBe⑧ERQ25#< ճy[Gֽ!i,cnʄ02-I*@|E6G~.[v쉌%w۔"ѩc۴CN/hP /[Kcz0.e(왡ztTЯXNP~1 ם0&0HXTZ l8y9/^!y92rɐί &_.^f/}"mh>nēB dR\ AxRv?k "r{C &&Pzɡʨ,W>PEz,Y{4谞'Ż0'ۤ7dȆLdNL{̠q4HF7ΰM9/|ϐ[7(BY5Fn)zwg+6ׁ]8hI}<60z!u`>BGI\i}<5lcbaa\bb #l=,Kr'6e8WjOQА#e<,0Z8byK ?_F&[(MߓŔKB5kiav 3 KˑzGyW= InF:˴[0% 6Z1scnTSiT؄р W&Ed+E7W0.]tRރsa!b0l6Q{QI'ݽy9=emR`ȋ3׾CM+FTDRdGlJd?!/r|&߀PԔ}qدt63XcseD %ݘݼ ,CA¡7pZj06!i>8M4G~&%&NUMJYd~r}}+,܋R V&yq Y'h=6Uwi?cp!7бWzc V;YljT-x}N [b; $N=Z>=83^7L+X%X#ƃx݉ nk7tڠZ+( Pd~(;&9VrMg7,n1Yx]'E1!ά~2v1ĺZɞt&nmC b4IʓBK#yXfܫ3"+\{.RrxJISv-.C<9ta3*UJ痦@ARfϿMɾcv58y#H`8_kg[A ^KN[Gb#ٶ.]l|U Ϭ7jO@yJy&5M>9l9_RT$|n>J@lcDRSQG.N :&S ũ֊)uͶ{d|~ HJtLS={jw/,yD7;=)ˉdKWk '/= <s}pieKtI!d3P3b[ rQ2:dsh[p\gE`W+G "sV3> !+nk ݵI6옘 ~gjz Q͡mTi j^ \g-f3"X陯 *Vm@7gzT[r֥#9xȃtyž =4D+"G1ke__]Sp7M|Jуܲ=xX9P-D#6_ߞO㌿>IyXG/!c2culnhHY4C Tg!8 @..JQݺ#f*ʜl-k}hRV/U) N] +֛Ҙ)E\UeͬSFߥX|.FF/֪!~vb; 6yUd*N;D|N7&xm$kH!g"@?զ^MUq–%GDoS+wf~z(e1ׇ)[tQ{Ѝrw oI~$2pYp}Ėa; 츜 w'5fF1jR] ,4zj!B1H'y{QK[jqE07ޢh -Zݑc_yڙ :KCpWĶύ*#o_J'2$d,9/K~e\nĶ+Q.`ug+vAB)ʷa: odqembvmkx"2cS}흂,\݅Ҭn`.vʱrP[9|ioIRg#C,|;ea޵cslp,s쇒 g֜5HH;DsY{vM[/_)n7֪O^R0 'FezC!Ipч)6f-{ 8َx'ϵEX=!Rhax(l_\=A. _5P3},;$15sƘxf1ͦ _Y:5T!j+qf;AR2RQU2O;+amhy4IC|N^1 $"5̢ [eqd>3NAT2x~OFjx?_g LQQJXd٢2T68 `2jGA;~Ŧ3gl~Ô,,iN{@M*'Z-?}QpP8M6y.+}/J ޑǯ흸le^gb:gWVJXnp)hEͥD V&ХIn"{X:RL\|{2Nd%k}v"S1kץk8 '3󚮔 m'U)?&T#<\.!#%.oT{ka Qﻹf,%v˿z/V3ّ1rJ!BNl'"峣瀻Rdf%o ;6.+OƱ[ {5-D>DG&q{mK,l!ΓI4iI>q[~^T<) Ƥax~ 국h ')|p* 9vr0^JUF_a%z=o+Ij¡ 1BCN||`貐! |cn[i=w;&'*ܕOB m 1!8\yAt (R/M0ŦaBOfc5-;q% F⧣ͿX%_ *FKfrQ6Rq!O+&PL|.Tv%H9o$dcDol?/xӷ&ۍ7M\åuLoXU2n+EH@ع<s[qw?o6Q_~PzM֣v$_[\dq6a'}}՜ZTUE-XR(eRE+alY{땁)R25ʑ2bwC,Ax'P."볥' &~9r"cyjUaA7)RN1D.A  ·bh'[ZzKs@xB(^qzx>,9r,]Ǯ)ha7}} GhFVm{Q{5 z*CH#ma@c+/aLp=xO 5mm79}3TӃe}':k悎X-8l;GXpMF4` <@2u#lWs L\~Nus-TUɼ˷Nj }Ј!C s}T}c^' n~Z M9;|s9Z}r2XqnfY֬S-FX.M}JLWTY,m=*)`DSԩ~!n^SY7qpc*)ךvGN1O*ejKCy8A65E<6Hw teThD,͇;) rLTfA=>_/Xh1WuM8}V4+@|"&}W(8qy!BRfJnGպ7|ocDݱ0mͿ4'Y}yܖ[N@k:dp$\t^gJʾNH}YbPSF[Z=spYk^*jN#8ֳ q-ܥ3ݢ>XSnx5xCcut q$aSM9 "/ԙt:cLZZo)3P'grcȈKջv۱כoz\,`. m+yF$\2T/xs u#Y[$u/R! %]OEʠTo"Ͻ#􏙧g;I5O76u% l>-29K__n~Qٳ7@}rS-~`I1Le:Mc!xk@[Iu#;ŀ`'zwK>uC&qrprp%j-yeN}\[7CfHlgdu6%Ut,(v= jZc>1)~3K(-:Q&.)G]c)emxc1rTsr&HWW('b1XzrnEg&%dE186FNq_ AȔs0Tv#"zB2Fy zy=2b)s Q#>t$ `6*(M憘|!3T O|mcs* 8Q#7f?Gos!ktOš2n2Bz=yCzC FxMg)+_pJjZ¬ǭ b,?VPr*؄1c' ^x1Kw\P7fkT]nX TF~ !1^ g2V XVB5ld ?f_>9]2Hle4P[.y b5ohiH]4ArZqGo@@pc6;)0 )qC;QWq+e!S_()O|D(AOj(P9gS,<˖A@2pe:"yj̙r}m䐵pNH`*z=$)ڽפ`-"ek(/y|CBjEO.4T}my.QMyVD7ZHH?,QFAƑrUs,tP:/mwmE i'e^4Ӂ=0C#Bv1sFa 9@zۀ, 4ԒlnOϯLwvrGќJ3nuv1w)R.R0u ͉ lW'=/\v)K xraao9N>Ǐ68%zJԠ>!9r=P]_?mU ![&+wOv,"j办VxD^`ey1#.t॔KXU346Wy.;N!\HJ`)S--o B.q1mo+#ߴ@, }}Kߑk iif[F}pm~uNwMA?bq^8K,0oI.ɚ] U:%#Вã/MUZ1u,A_uc,h˓QsI`&FP_YT͘At_ `{< 뤓ʚ'e[yn&(;smSX`\vCX$; $ET7c}t!HĔD"-->Z1ܕAX@_ڬ?*kX_Hx $< %kBl61z&v jb |I wgG!?C!F0bQrHg͞!0A4w>9g*{/@pO? vJ5NG+]tC3{I@fbz˓SԀH'KAa߿=q %qJWl!}5EjC\T_$.@ޒ#YҡL e[·Uq< $ka3B+wtyyϭW5 tqXk2]vH9#wJp>lR$ AZz^15uĖt۴Ȍ;fPGeb4X5j,Zhxdk>Nz¶vœjiV4J n5`#0d9`vQJ<:, `iJ!IT X!QG>TFٶdT/ϥ(9v[-C$oio}_x@ (eƞVpRҔJ%L.y\ՎTU%vcP"/XXykAg&lWa:}1-8b6BB$ge |oDɫLE{80X+] TIM"@P.x(x$V—,Cfr_S챱^@ H{?j!5GŊO^c`q[JO`ƺJ$ .:΍'! QU0c׍ąN'|.墣Lc9wfʠqP=5.`haCʚ#JEraww*-Va^jFJ?PֺוeSánCӁFFHNy@4q^J^Op-=:ը  9_!1trkd5a 9!f |ʡZqT(pCl{hMEF C,FN&.۰U*PD!0;#3ʣLR6?` Q qw:0!=$.:%Bjhyi.˹-Q5˾_XT0wP/W Bʅ sG 9b?g]$`)L='jPF<#9Zb?J^ISuC)"Ń Wm"$+Kg7ۏ8CD?LS.=fL=1lߖ3#GYu)wԐ ?LէA󀎱c?+sսQjȺMT8Шu"aQcOшI0G0\u؉EQ!o0o3$  (#kL:%OyO9]_4T@LZE ߡjpwFD+u2l'i\sGd+B/,i'ѵ#Ņ-CMIt~$ϜE@*(@)ɰ#~2Ƀѝ>շ}ec]]ύ p *q}ǸbpJO6%jF߾wVm%_[7̹J3cCCC@)|+6S} MRt_!\:Z%!vL|qPq'[# ![(=%*-}x~ $*\*hoVs:N#"jtx?DwQ0>|I ˊf$3;@VP澄 %Ӝlb]+}=zlTQ [GdUZ7%}!ioɊ@zp NFz۳˃#ĽԪ]1FΞugSGD%s~ЎYѲZ/9ͣ¹ǹHƘMʄl)Y5dY!3kQ^޸_ƹ"eFD#33kYtj>6P!Бl/&0ej0VboVqIZM4Xy0UlZL,YV蝯 xQUC;l -A(Пj~ Ы|}5'IQcd>amS9'Ogw:o s>z(a#+΄W~%Te̕ 0YakNCy% Hh f+vFNY LeHxC,$}ZpEl)@?[GD9rzڪ* T#7[a ~$sm@r HlF9OxFj1d 8<*+16`-t2蜓n{q%8*7Dΐ?RR"8v iXj}|,2O 7C]$'FTSbq+qAu:a)F:ck0N% U˃uk4A)jUMp쮇8 EwnW`W"ˏ3:7o림Sp!v>/E$Y2.;#x=gO7NGL-OA.-",SU+?X:0ڰ-O&8=pQQy2{-'ŜyRS"絮nUe LsjI)aF X׈^{BXEA  1W=[/_OGV? )[Iz*!,IOQmKKR,:3MӔ> btơu1lՅePfeoSP@1VSz"Iq,xY4cO/<8?~%r 9캐[:Xl0B71jj )F˅ 0^9""4ah7=.J[HcӖd4ѠѮl/HC!0_ޣpx. }nBܷF6MF=ʼns;lIǟ D0پ[_׉t),TQޠ/$kwޢhR %]oO4~o0o٠]\ A2 ¢~h\(!XcLNKMX\Ug}n To@gL[<zgi @v&CV(_;i6,Qw/W{b;@{h 8!]F#rQFyٽ,W~={k&'jw,B҈ӒQd\lG %??! ]Te}ðhϛ?nAj)}G0 j3=S.Ys>u1GzR٦{8h~KS[Yqenfk6(ץ,9&Kښp7V#^9OCeòp[PIi&+pSFbP3K(1gPޛ~, Pa孽6N@} K h__;kܾz:'IC=~,^{nln8]V}S>$ k2g蠋kE vϑ}!ڻbG6g茪8ae8`$ԜLz"x~ |~ s h~ 8[#i 1 Ȁ _ * >! ~  $ S u 9\ G Y\ MU~ 8[ RR ~ c~  @RR RR$O ShEEE$O FPFFFFS$O GhGGh8hh)h6h@AhAPhBahmhCc LtQyhV hhh hhhhhhii*i>iRiZ Z [ fitiiiiiiiij j +j Fj `jyjjjjjjkk k0kAkNk [k@mkkkkwmmmmmmmm m n (n:nNnbnmn~nnnnnCnnno o(o;oLoco(vo*o+o,o-o.o/o0o1 p2p3*p<>pFPpGgpPwpVpZpdpmpnpoppqqr#qs9qtOqpqWq_qgqoqxqopenssl-3.5.1-7.el9_7.x86_64.debug{7zXZִF!t/_g]?Eh=ڊ2Nc=3u1&t%mNpm1nӂI'Ҽ]`v X&υ+eɒ9ٺC/ 2k^`鸶'([sDEK}!vMG+;sK?&B7BÁQg-r뼭Mӏ\{3EVrW"\ ;\cc}{ G4]'lAǑUw2b` v0v1'J:wec̱: Eli(NѦO :`Fޭ%xNF}Orld~/jnpTwZt͇\t6}M]c8(_Uܿ{}m7 ȪIJX-WXXњhFJR++,CKށ˗flմ0G XX7_Qu38:h)|њ ԫYag$q=ߤȂ V@m@햭 4[&JO"ǔ?. W,C9-Eq1 <ȯ:׫&T$ T_KlrIo2]\>yJ.,-ʶb͉Nv(O {/#hc us6vn8.!~upԟl C-btK<@}NBs?B&ܪ %Usg"ʄ0~ZLW>R.6%)@!'!D=BQRk{S qO~x;|Fb,Y;`"Dvh"˳Nۡ^y x;V.@rTG p̊L?vUwq,cw. FlЏ9`O n4Pxaل"MJ 0F 3NNECaJT1g3Ņ>{<,_q@a v^L=?] 7XW{TF#FQ$jrPJrdA.P?R!$vGs6`A*xx8B@ϱ˦Ihv<_͂+_^\63²5aei"du40'AA'U/{zb~st Ե_х;Dqk8_:* ibc/rN _ԅ-˥@,B &O䒀N, ?5+:aB*>p $lͻj4} s(FtÃP\atH/"!i) YQ%୐#]ҮT+ok)79Z%u(dݎsR^&;OHKpgD˸kMx5VHʒoS•iZN<pb=^rAh=W6'Pg^u/#]",XceXP 1њwQr4s4 ͗bdZ#Ӡ06*JAU7M}=<s+.>h-|JCdߞX[ǵO, Ր$T^ ` b&̷hd6WL#y7= ;ZoDraɮ4eHtJF,z6W>OR"Sh(KH%SX>/Yj?uwɀϬ\lcdVp۫p-|~=w&u- z)_ ܊GPWi> |idq0UCc%L+;!4=m$|B]3XІ>{p<entK\ሰ3!Ի 9Zc%6^K3 {U0b9V?.( *Aonm"zN!`T  d^&GI67"u).\H|._0dUPĝ[1%B0MH["gqa 0)J qd^.ћ%F#B|MS_Y41Ն߅7lQ$+\~ouM<4ʒ$1 eP22-VY JSpjʟ>oiCJ:P1̥(쩹 z]=HW^y(Q.Cڢ2Onſ-9J Jaz~3 }L /IvB$§HYc]hO$,='%+5!T02YN-) 8g?d}41o|0Q+ ;}\2k͜Z+šql֣boM%/)l3tu(rwV8 *HjCFs5ur^-FV +?DŽ.ep{4i&^[vg/{.M jeJCÇa@&{훩0 hr@lv2}yX^6yO>Jԣ7!h7Rז0Qo ʘ|v[ Ð3SqmH617ΎuGk8 ;W*Pe4`d#=BLTv.S0LNu.WHDZYT1JF*͑M8Ԫ;@oAߚ^gJABA%2̕'/YèzGB#ql޳g.k dHf "p U-G>ͅAޭ9Kb_& {7c$P,]L)HlRlVB,,xH=ϋ,t;m0"A e\:VHN~-:`'s[\rakH5{S߇Yip̚8i3R cQ킔hɭJ {g &5}Hn887˶P ;</ PK/t'y}CR!&]1x'TV\9E%/2fYAIF5}GhpJlvދƚn4hDGf<Ț@^ ԃP.>d=M] "Jq7x5i7$x Χn. r>#Z >b| f0皿FNԾU T/c1BF S#-?wD_0HGL^Muo ('@<])X9~bSƢ7͜$#;yBP}]p*K7du:B%D&^&zy.oZRun5C0g$7ߟPG"DKϵIjwVyP5vowJRz |[ vLUz04.}](ɀh*磕 ׮+?$MClS hi-9hH$LR{t|ɋZӽڬ<ڪke;HId#/* Lw֦PkaO[ی g?)JYXՙ:LL_*5(Yj`ˣaʳ 6a>yhڳej<+rZ(ð&y:`~*,󌲁&sHU@XD8F4Jouw 0 m#2,8AJԺ]f7uaV+YatU<yЯhEGuK~R{Gs"gA/7<&a|-6zY*z]V8K(P5)HgϟlDG@?[ugc^s M; K!H+!%Ŗ*9F+熴d?k2RYl/W&X؍,h# }~ĉK$KqYp\_&q'7~kUAYjiL̐*!~i{ X$uarXG4RcFH fv_hH!ei.r<272!;KND>yBm==%"ff_8}s #]C//J,%J>T=XO"LJn$#!%bT $;UOg*k)Cļk%$}nG_Z ;ca5eɦ,>\4ShtB PL݅Ӓܲ~IQBmϰyC!HxjJ/O&x}*5(c=]xTrFQ9JwxԵn=ʶ)Ή|eԍ}Xs=z{B A5=D9tsM-~3n.\ :KT~ \1._n l^ٳ<}K1 '$i$V䴆柦/&?A]on-}02#8.=5e"I6lГd\isoP:][%&n&Cs쮖D}rRo;7M +%FA+ 7_QnCAn+w x<^mk%v/ۧG3ޡg /^H' o5Wl^n,0e,2S;]GLd;;K/VxPw$S<%(ԣ3-gYZ.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata 880&hh$9 Go0Q YLaoD+D+B no88`}99&B``  hhhph,  P PPLK;K;K;@ G7I96p@~ @@G @(h0(